DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PROS1 and Ser8

DIOPT Version :9

Sequence 1:NP_001301006.1 Gene:PROS1 / 5627 HGNCID:9456 Length:708 Species:Homo sapiens
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:166 Identity:43/166 - (25%)
Similarity:68/166 - (40%) Gaps:29/166 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   556 LALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEF---RVNRNNLE 617
            |||::..|.....:.|...||.....|:....:::..|...:||   |:|...|   .:..||: 
  Fly     9 LALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSL---QRSGSHFCGGSIISNNI- 69

Human   618 LSTPLKIETISHEDLQRQLAVLDKAMKA--KVATYLGGLPDVPFSATPVNAFYNGCMEVNINGV- 679
                  |.|.:| .|.....|.:..::|  ...||.|.|.:|  :|...:..||...::|..|| 
  Fly    70 ------IVTAAH-CLDTPTTVSNLRIRAGSNKRTYGGVLVEV--AAIKAHEAYNSNSKINDIGVV 125

Human   680 ----QLDLD---EAISKHNDIRAH-SCPSV--WKKT 705
                :|...   :||:..:...|| |..|:  |.||
  Fly   126 RLKTKLTFGSTIKAITMASATPAHGSAASISGWGKT 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PROS1NP_001301006.1 GLA 58..117 CDD:214503
EGF_CA 151..187 CDD:238011
Plasmod_Pvs28 166..325 CDD:283826
FXa_inhibition 200..231 CDD:291342
EGF_CA 233..273 CDD:284955
FXa_inhibition 279..314 CDD:291342
Laminin_G_1 361..491 CDD:278483
Laminin_G_2 546..679 CDD:280389 31/127 (24%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 36/141 (26%)
Tryp_SPc 35..253 CDD:238113 36/140 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.