DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zgc:171775 and rl

DIOPT Version :9

Sequence 1:NP_001104637.1 Gene:zgc:171775 / 562552 ZFINID:ZDB-GENE-030131-4309 Length:359 Species:Danio rerio
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:348 Identity:138/348 - (39%)
Similarity:218/348 - (62%) Gaps:9/348 - (2%)


- Green bases have known domain annotations that are detailed below.


Zfish    14 IQKTTWDVPDRYTSLKPVGSGAYGTVCFAVDQKTKEKVAIKKLYRPFQSLIHAKRAYRELRLLRH 78
            |:...::|..||..|..:|.||||.|..|.|..|.::|||||: .||:...:.:|..||:.:|..
  Fly    27 IRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQRTLREITILTR 90

Zfish    79 IQHDNVICLLNVFTPDSSLEKFDTFYMVMPFVAQDLGHIMKRKQLTSNVITYLFYQILRGLKYIH 143
            .:|:|:|.:.::...| |:::....|:|...:..||..::|.::|:::.|.|..|||||||||||
  Fly    91 FKHENIIDIRDILRVD-SIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIH 154

Zfish   144 SAGIIHRDLKPNNLAVDENCELKILDFGLARHTETE------MTGYVVTRWYRAPEVIFNWMHYT 202
            ||.::||||||:||.:::.|:|||.||||||..:.|      :|.||.||||||||::.|...||
  Fly   155 SANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYT 219

Zfish   203 QTVDVWTAGCILAEMITGEVLFPGSDSIDQLKKILNLTGTPNSTLVLKMQSKDAQSYVRSLPVQK 267
            :::|:|:.|||||||::...:|||...:|||..||.:.|:|:...:..:.::.|::|:.|||.:.
  Fly   220 KSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKP 284

Zfish   268 KKAFKEVFSGMDPNAIDLLEGMLVLDPEVRLSAKNGLSHPYLSEFHDPENEPVSP-PYDDSFESM 331
            ...:.::|...|..|:|||..||..:|..|:..:..|:||||.:::||.:|||:. |:..:.|:.
  Fly   285 NVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMEND 349

Zfish   332 DLAVSEWKSLIHMEIMTFDPNNP 354
            |::....||||..|.:.|....|
  Fly   350 DISRDALKSLIFEETLKFKERQP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zgc:171775NP_001104637.1 STKc_p38 9..351 CDD:143356 137/343 (40%)
S_TKc 25..309 CDD:214567 118/289 (41%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 135/335 (40%)
S_TKc 38..326 CDD:214567 118/289 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.