powered by:
Protein Alignment si:ch211-207l14.1 and sel-11
DIOPT Version :9
Sequence 1: | XP_021332673.1 |
Gene: | si:ch211-207l14.1 / 562414 |
ZFINID: | ZDB-GENE-120215-234 |
Length: | 221 |
Species: | Danio rerio |
Sequence 2: | NP_505969.1 |
Gene: | sel-11 / 179612 |
WormBaseID: | WBGene00004768 |
Length: | 610 |
Species: | Caenorhabditis elegans |
Alignment Length: | 59 |
Identity: | 21/59 - (35%) |
Similarity: | 31/59 - (52%) |
Gaps: | 4/59 - (6%) |
- Green bases have known domain annotations that are detailed below.
Zfish 150 VMSMSD---ADSLCLICHGDLRKGGGVIRELHCSHSFHSECIEEWLWTKQTCPTCHKHV 205
|:|..| .|:.|:||..::...... :.|.|||.||:.|:..|...:||||||...:
Worm 279 VVSAEDLAAMDATCIICREEMTVDASP-KRLPCSHVFHAHCLRSWFQRQQTCPTCRTDI 336
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.