DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:ch211-207l14.1 and sel-11

DIOPT Version :9

Sequence 1:XP_021332673.1 Gene:si:ch211-207l14.1 / 562414 ZFINID:ZDB-GENE-120215-234 Length:221 Species:Danio rerio
Sequence 2:NP_505969.1 Gene:sel-11 / 179612 WormBaseID:WBGene00004768 Length:610 Species:Caenorhabditis elegans


Alignment Length:59 Identity:21/59 - (35%)
Similarity:31/59 - (52%) Gaps:4/59 - (6%)


- Green bases have known domain annotations that are detailed below.


Zfish   150 VMSMSD---ADSLCLICHGDLRKGGGVIRELHCSHSFHSECIEEWLWTKQTCPTCHKHV 205
            |:|..|   .|:.|:||..::...... :.|.|||.||:.|:..|...:||||||...:
 Worm   279 VVSAEDLAAMDATCIICREEMTVDASP-KRLPCSHVFHAHCLRSWFQRQQTCPTCRTDI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:ch211-207l14.1XP_021332673.1 RING-H2 160..201 CDD:319362 15/40 (38%)
RING-H2 finger (C3H2C3-type) 160..201 CDD:319362 15/40 (38%)
sel-11NP_505969.1 HRD1 51..>333 CDD:227568 20/54 (37%)
zf-RING_2 291..333 CDD:290367 16/42 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.