DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:ch211-207l14.1 and Lnp1

DIOPT Version :9

Sequence 1:XP_021332673.1 Gene:si:ch211-207l14.1 / 562414 ZFINID:ZDB-GENE-120215-234 Length:221 Species:Danio rerio
Sequence 2:NP_001333971.1 Gene:Lnp1 / 100503609 MGIID:5011982 Length:178 Species:Mus musculus


Alignment Length:180 Identity:45/180 - (25%)
Similarity:65/180 - (36%) Gaps:56/180 - (31%)


- Green bases have known domain annotations that are detailed below.


Zfish    19 EEREDDEEQGE---------------EEEDEQEEEEPEAERKSSWDIPIPSRSLASRRASLPCPA 68
            |.|:||::..:               .::||:...:.:..:::|:           |:|||||  
Mouse     2 EHRDDDDDNDDVSFAKWMSSFWGHSWRDKDERGLRDHQQLQEASY-----------RKASLPC-- 53

Zfish    69 QLKAMHLSRTHSAAVIPSPAVLSHCLQSSAARPCSRFSHVGKNEDVTHTKSSLYERQPHTISTIP 133
                            |.||..|  :.||...| .|.||    || ..::|.|..|.....|...
Mouse    54 ----------------PFPAFPS--ITSSDCHP-RRHSH----ED-QGSRSHLPTRHHRKCSVDG 94

Zfish   134 EVHEPLERKARFRSR-NVMSMSDADSLCL---ICHGDLRKGGGVIRELHC 179
            .:.||.|.:.|..|: ...|.|....|||   ..|....||.....|.||
Mouse    95 SLREPTESQRRAHSKMQEFSESFERHLCLQTKPSHSVGPKGKKERDERHC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:ch211-207l14.1XP_021332673.1 RING-H2 160..201 CDD:319362 8/23 (35%)
RING-H2 finger (C3H2C3-type) 160..201 CDD:319362 8/23 (35%)
Lnp1NP_001333971.1 LNP1 13..175 CDD:373833 41/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009359
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7097
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.