DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MOSPD1 and SCS2

DIOPT Version :10

Sequence 1:NP_062456.1 Gene:MOSPD1 / 56180 HGNCID:25235 Length:213 Species:Homo sapiens
Sequence 2:NP_011046.3 Gene:SCS2 / 856856 SGDID:S000000922 Length:244 Species:Saccharomyces cerevisiae


Alignment Length:57 Identity:17/57 - (29%)
Similarity:27/57 - (47%) Gaps:4/57 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    17 VFVFPTELIFYA--DDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKP 71
            |.:.|..|::.:  .:|||  :..::.|..:..:.|||..|.|..|.|...|..|.|
Yeast     4 VEISPDVLVYKSPLTEQST--EYASISNNSDQTIAFKVKTTAPKFYCVRPNAAVVAP 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MOSPD1NP_062456.1 Motile_Sperm 16..115 CDD:459882 17/57 (30%)
Nuclear export signal. /evidence=ECO:0000250|UniProtKB:Q8VEL0 205..208
SCS2NP_011046.3 SCS2 2..244 CDD:227398 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.