DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MOSPD1 and mospd1

DIOPT Version :9

Sequence 1:NP_062456.1 Gene:MOSPD1 / 56180 HGNCID:25235 Length:213 Species:Homo sapiens
Sequence 2:XP_012823781.1 Gene:mospd1 / 548478 XenbaseID:XB-GENE-877098 Length:217 Species:Xenopus tropicalis


Alignment Length:215 Identity:183/215 - (85%)
Similarity:201/215 - (93%) Gaps:2/215 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDA 65
            |.|||||||||||||||||||||||||||||||||||||||||||||||||||||:|||||||||
 Frog     3 MQQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTSPNKYVVVDA 67

Human    66 AGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKE-QQKEEE 129
            ||||||||||||||||:|||:.|:||||||||||||||.|||||||||:|.||||||| |||:||
 Frog    68 AGAVKPQCCVDIVIRHKDVRASHFGVIDKFRLQVSEQSHRKALGRKEVIAMLLPSAKEQQQKDEE 132

Human   130 EKRLKEHLTESLFFEQS-FQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSV 193
            |||:|||..||:||||: .||:.|..|||||||.||||:|||||||:||||::||:|||||||||
 Frog   133 EKRMKEHFAESVFFEQAPSQPDTRNSSSGPSLLMVFLGMVCIAALMMPTLGEMESMVPLYLHLSV 197

Human   194 NQKLVAAYILGLITMAILRT 213
            ||||||||:|||:||.:|||
 Frog   198 NQKLVAAYVLGLVTMVVLRT 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MOSPD1NP_062456.1 Motile_Sperm 16..115 CDD:334183 92/98 (94%)
Nuclear export signal. /evidence=ECO:0000250|UniProtKB:Q8VEL0 205..208 1/2 (50%)
mospd1XP_012823781.1 Motile_Sperm 18..115 CDD:334183 90/96 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H128711
Inparanoid 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1197131at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3703
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.