DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRKX and CG4839

DIOPT Version :9

Sequence 1:NP_005035.1 Gene:PRKX / 5613 HGNCID:9441 Length:358 Species:Homo sapiens
Sequence 2:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster


Alignment Length:314 Identity:121/314 - (38%)
Similarity:188/314 - (59%) Gaps:13/314 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    45 SLQDFDTLATVGTGTFGRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSV-LKEVSHPF 108
            ::.:...:||:|.|.||||.||...  :...|||::...:|::..|.:||:|||:| :|....||
  Fly   690 AISELKKIATLGCGAFGRVDLVAYN--QQALALKIIKKIEVVKQDQIEHVYNEKNVMIKCRQSPF 752

Human   109 LIRLFWTWHDERFLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDL 173
            :::|:.|:.:::::|.|||...||::::.:..|..|...|..|.:..::.|.:||||...:||||
  Fly   753 IVQLYRTYRNDKYVYFLMEACMGGDVWTVMSKRQYFDEKTAKFIAGCVVEAFDYLHSHHFIYRDL 817

Human   174 KPENILLDRDGHIKLTDFGFAK--KLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFE 236
            ||||::|..||:.||.||||||  :..::|.|..|||||:|||:|..:||.||||:||||||::|
  Fly   818 KPENLMLGTDGYCKLVDFGFAKFVRQNEKTNTFAGTPEYVAPEIILDRGHDRAVDYWALGILVYE 882

Human   237 MLSGFPPFFDDNPFGIYQKILAG--KIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKH 299
            :|.|..||...|...|||:||:|  .|..|..:....:.|::.|.......|||..:.|..|:|.
  Fly   883 LLVGKTPFRGVNQIKIYQQILSGIDVIHMPSRIPKSAQHLVRHLCKQLPAERLGYQRKGIADIKR 947

Human   300 HRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNF-ETYPENDWDTAAPVPQKDL 352
            |.||.|:||:.:..::|..||...:....|...| .:..|||::     |.::|
  Fly   948 HSWFESLDWQRLKLKQLPSPIKRPLKSWTDLQYFGPSGVENDYE-----PPEEL 996

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRKXNP_005035.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
PTZ00263 39..358 CDD:140289 121/314 (39%)
STKc_PRKX_like 47..338 CDD:270763 116/296 (39%)
CG4839NP_609349.1 Crp 428..577 CDD:223736
CAP_ED 431..539 CDD:237999
Crp 544..>650 CDD:223736
CAP_ED 550..663 CDD:237999
S_TKc 695..951 CDD:214567 106/257 (41%)
STKc_cGK 700..957 CDD:270724 108/258 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.