DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRKX and Pka-C1

DIOPT Version :9

Sequence 1:NP_005035.1 Gene:PRKX / 5613 HGNCID:9441 Length:358 Species:Homo sapiens
Sequence 2:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster


Alignment Length:294 Identity:157/294 - (53%)
Similarity:222/294 - (75%) Gaps:0/294 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    45 SLQDFDTLATVGTGTFGRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFL 109
            :|.||:.:.|:|||:||||.:|:.|..|.::|:|::....|::|||.:|..|||.:|:.:..|||
  Fly    42 ALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFL 106

Human   110 IRLFWTWHDERFLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLK 174
            :.|.:.:.|...|||::|||||||:||:||..||||.....||:|:|:.|.||||..:::|||||
  Fly   107 VSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLK 171

Human   175 PENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLS 239
            |||:|:|..|::|:|||||||::..|||||||||||||||:|.|||:.:||||||||:|::||.:
  Fly   172 PENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAA 236

Human   240 GFPPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFR 304
            |:||||.|.|..||:||::||:.||.|....:|||::.||.||.|:|.||:|.|.||:|:.:||.
  Fly   237 GYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFA 301

Human   305 SVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPE 338
            |.||.|:.|:|::.|.:|:..|.||||||:.|.|
  Fly   302 STDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRKXNP_005035.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
PTZ00263 39..358 CDD:140289 157/294 (53%)
STKc_PRKX_like 47..338 CDD:270763 155/290 (53%)
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 154/288 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277423at33208
OrthoFinder 1 1.000 - - FOG0000539
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100326
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.