DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PCDHGB3 and cdh-8

DIOPT Version :9

Sequence 1:NP_061747.2 Gene:PCDHGB3 / 56102 HGNCID:8710 Length:929 Species:Homo sapiens
Sequence 2:NP_001294412.1 Gene:cdh-8 / 184652 WormBaseID:WBGene00017576 Length:1684 Species:Caenorhabditis elegans


Alignment Length:836 Identity:194/836 - (23%)
Similarity:327/836 - (39%) Gaps:246/836 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    18 FLFLLSLLD-----QALSEPIRYAIPEELDRGSLVGNLAKDLGFGVGDLPT----RNLRVIA--E 71
            ||.||..|.     |.|.||....:.|:...|:              .||.    :|:::::  .
 Worm    10 FLILLGCLKGTDSAQLLIEPSFLLVEEDWPVGT--------------HLPVTICPKNVKILSGDP 60

Human    72 KKFFTVSPENG-------NL-LVSDRIDREEICG----------KKSTCVLEFEMVAEKPLNFFH 118
            ..:|||...|.       || |.:|:.:.:.:.|          |||...||.::|         
 Worm    61 ASYFTVVKINETCSTLQLNLALDADKENADGLRGQSFSLVIAGPKKSRATLEVQIV--------- 116

Human   119 VTVLIQDINDNPPTFSQNITELEISELALTGATFALESAQDPDVGVNSLQQYYLSPDPHFSLIQK 183
                  |:|||.|.||...:..||||.|..|......:..|||.|::.:.::.:..|..|:|.::
 Worm   117 ------DVNDNSPQFSNTPSSFEISENAEIGTDIFKVTTLDPDTGISGISRFSVEGDSSFTLAKR 175

Human   184 ENLDGSRYPELVLKAPLDREEQPHHHLVLTAVDGGEPSRSCTT---QIRVIVADANDNPPVFTQD 245
            :...|....:|.|...||.||:|.|...:||.||...|....|   .:.:.|.:.||.||.|..|
 Worm   176 KCSSGKCSTQLRLAKKLDFEEKPIHTFNITAKDGDPHSNRTHTVAHTVTIHVKNENDEPPKFLTD 240

Human   246 MYRV-NVAENLPAGSSVLKVMAIDMDEGINAEIIYAFINIGKEVRQLFKLDSKTGELTTIGELDF 309
            ..:| .:.::...|..:.|:.|||::.|       |.|..|.:..:..|:|||:|.:.    |..
 Worm   241 FSQVFPIFKSTKPGDIIAKLEAIDVENG-------AEIQFGMKENEHLKIDSKSGNVL----LKK 294

Human   310 EERDSYTIGVE-----AKDGGHHTAYCKVQIDISD--------ENDNAPEI-------------- 347
            ...|...|.||     :|:|...|...|::: ::|        ||...||:              
 Worm   295 LPTDDALITVELYATSSKNGKSKTVEMKLRL-MNDEATLPKIAENQEKPELCEFPIYEAHLIQGT 358

Human   348 ----------TLASESQ--------------------HIQ---EDAE------LGTAVALIKTHD 373
                      ||.|.::                    |::   .:||      |.:|..|:|:. 
 Worm   359 GTFSTPLKIKTLKSMAEEKPRLIGGSESFDLNVIDDFHVELKVLNAEKVASQVLDSAQLLVKSQ- 422

Human   374 LDSGFNGEILCQL--------------------------KGNFPFKIVQDTKNT----YRLVTDG 408
                 :|:  |::                          |..:.|::|::.:.|    .::::||
 Worm   423 -----SGQ--CRIVLRSAAQMTPKASPIAQKLKIIPKFEKSEYQFQVVENREPTVLGEVKVISDG 480

Human   409 --------------------------ALDREQIPEYNVTITATDKGNPPLSSSKT-ITLHILDVN 446
                                      .:|||...::.:.:.|||...   ||.|: :.:|:.|.|
 Worm   481 PVTYEILGENGEKFQISNDGEIQNLEPIDRETYEKFELIVKATDLNG---SSGKSQLIIHVKDEN 542

Human   447 DNVPVFHQASYTVHVAENNPPGASIAHVRASDPDLGPNGLVSYYI------VASDLEPRELSSYV 505
            ||.|:|.:..|.:.|.|.......|.   |:|.|.|.||.:.|.|      :..|:.|       
 Worm   543 DNSPIFDKEHYFITVDEGKSEKLKIT---ATDADSGKNGQIVYSIDQKIDNLPIDISP------- 597

Human   506 SVSARSGVVFAQRAFDHEQL---RAFELTLQARDQGSPTLSANVSLRVLVDDRNDNAPLVLYPAL 567
                 .|::|. .|.|.|.:   ....||:.|.|.|.|..||:.::.:.|.|.|||:|:.     
 Worm   598 -----DGMLFI-GAIDRENMGNSNEVNLTVTASDSGEPKRSASATVTIRVKDINDNSPVF----- 651

Human   568 GPEGSALFDMVPRSAEPGYLVTKVVAVDADS-GYNAWLSYHIVQASEPGLFSLGLRTGEVRTART 631
              ..|.....:..:..||.::.::.|.|||| ..|.:::|   .:.:| .|::. .:||:.....
 Worm   652 --SNSRYSIPLDANISPGGIIGRLEATDADSTSPNNYVTY---TSGDP-KFTVS-DSGEILFTGP 709

Human   632 LGDREAARQRLLVTVRDGGQQPLSATVMLHLIFADSLQEIQPDLSDRPTPSDPQAE 687
            ....::|.....||.:|||....||..::.:....|::.|:.:|:.:...:|...|
 Worm   710 GTLEKSASLEFNVTAQDGGDPMNSANALVVINEHRSMKSIENELTTQINSNDTGGE 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PCDHGB3NP_061747.2 Cadherin_2 32..112 CDD:311943 21/103 (20%)
Cadherin_repeat 139..238 CDD:206637 30/101 (30%)
Cadherin_repeat 247..343 CDD:206637 27/109 (25%)
Cadherin_repeat 355..448 CDD:206637 27/158 (17%)
Cadherin_repeat 456..558 CDD:206637 30/110 (27%)
Cadherin_repeat 578..662 CDD:206637 21/84 (25%)
Cadherin_C_2 687..769 CDD:318652 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 791..838
Cadherin_tail 808..>902 CDD:318236
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 899..929
cdh-8NP_001294412.1 Cadherin_repeat <55..121 CDD:206637 17/80 (21%)
Cadherin_repeat 131..232 CDD:206637 29/100 (29%)
Cadherin_repeat 457..544 CDD:206637 17/89 (19%)
Cadherin_repeat 552..647 CDD:206637 30/110 (27%)
Cadherin_repeat 656..741 CDD:206637 21/89 (24%)
Cadherin_repeat 861..952 CDD:206637
Cadherin_repeat 964..1060 CDD:206637
Cadherin_repeat 1184..1265 CDD:206637
Cadherin_repeat 1275..1375 CDD:206637
Cadherin_repeat 1396..1476 CDD:206637
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I8810
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.