DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP2K7 and hep

DIOPT Version :9

Sequence 1:XP_006722863.1 Gene:MAP2K7 / 5609 HGNCID:6847 Length:442 Species:Homo sapiens
Sequence 2:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster


Alignment Length:493 Identity:247/493 - (50%)
Similarity:297/493 - (60%) Gaps:84/493 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     5 SLEQKLSRLEAKLKQENREARRRIDLNLDISP--------QRPRPIIV---ITLSPAPAPS---- 54
            ::..:|..|||||:.:| |:..:|.|:....|        .|..|:..   ...|...|||    
  Fly     8 TIGSRLQSLEAKLQAQN-ESHDQIVLSGARGPVVSGSVPSARVPPLATSASAATSATHAPSLGAG 71

Human    55 ----------QRAALQLPLANDGGSRSPSSESSPQHP---------------TPP---------- 84
                      ||.|..:|.|...||.|.||.||....               |||          
  Fly    72 SVSGSGISIAQRPAPPVPHATPFGSASASSSSSSASAFASAAPATGTFGGTYTPPTTRVSRATPT 136

Human    85 --------------ARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEIND 135
                          .|| .:|.||:....|.|    |.|.||:.||:|||.|.|.|::|..:|||
  Fly   137 LPMLSSGPGGGLNRTRP-VILPLPTPPHPPVS----ETDMKLKIIMEQTGKLNINGRQYPTDIND 196

Human   136 LENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFG 200
            |::||::|:||.|.|.||....:..:||||||||:||.|||||||||||||||||||.|||:|.|
  Fly   197 LKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCLG 261

Human   201 TFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNI 265
            .|:.:.||:|.||||..|.:||.|..:.|:||:||||:|||.|.||.|||:||||||||||||||
  Fly   262 CFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNI 326

Human   266 LLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLPC 330
            |:||||.|||||||||||||||||.|||||||||||||||   ||.||.||||||||||||:|  
  Fly   327 LIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERI---DPKKPKYDIRADVWSLGITL-- 386

Human   331 PSPSQVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMG--FSGDFQSFVKDCLTKDHRKRPK 393
                 |||||.:.||:.|.||||||||||..|||.||...|  ||..|:.||..||||:|:.|||
  Fly   387 -----VELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPK 446

Human   394 YNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSG 431
            |.:||...||:.||:.:|||.:||:.:  |....|.:|
  Fly   447 YPELLAQPFIRIYESAKVDVPNWFQSI--KDNRLRANG 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP2K7XP_006722863.1 PKc_MKK7 120..423 CDD:270791 197/304 (65%)
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 198/306 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 356 1.000 Domainoid score I989
eggNOG 1 0.900 - - E1_KOG0983
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56548
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1923
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 1 1.000 - - FOG0005845
OrthoInspector 1 1.000 - - oto90112
orthoMCL 1 0.900 - - OOG6_107093
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3854
SonicParanoid 1 1.000 - - X4836
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.660

Return to query results.
Submit another query.