DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK13 and p38a

DIOPT Version :9

Sequence 1:NP_002745.1 Gene:MAPK13 / 5603 HGNCID:6875 Length:365 Species:Homo sapiens
Sequence 2:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster


Alignment Length:355 Identity:205/355 - (57%)
Similarity:261/355 - (73%) Gaps:5/355 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIF 65
            ||:...|.|||.|:|:|.||:|..|.....|||||||.|..|:.:.:...||||||:|||||.:.
  Fly     1 MSVSITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVH 65

Human    66 AKRAYRELLLLKHMQHENVIGLLDVFTP---ASSLRNFYDFYLVMPFMQTDLQKIMGME-FSEEK 126
            |||.||||.|||||.|||||||||:|.|   ..||.||...|||...|..||..|:.|: .|::.
  Fly    66 AKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDH 130

Human   127 IQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAP 191
            :|:||||:|:||||||||||:||||||.|:||||||||:||||||||..:.||||||.|||||||
  Fly   131 VQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENEMTGYVATRWYRAP 195

Human   192 EVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAK 256
            |::|:||||:||||||||||||||::|.:|||.|.|::.||..|:::.|.|..||::|::.::|:
  Fly   196 EIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESAR 260

Human   257 SYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQ 321
            |||||||....:.|..:|..|:|.|.||||||||||.:||:||.:||:||:.|.:.:|..| :..
  Fly   261 SYIQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVE-QTS 324

Human   322 QPFDDSLEHEKLTVDEWKQHIYKEIVNFSP 351
            .|:|.|.|...|.||:||:.||||:.||.|
  Fly   325 PPYDHSFEDMDLPVDKWKELIYKEVTNFKP 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK13NP_002745.1 STKc_p38delta 9..351 CDD:143384 201/345 (58%)
TXY 180..182 1/1 (100%)
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 201/345 (58%)
S_TKc 25..312 CDD:214567 174/286 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 1 1.000 - - FOG0000533
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X352
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.