DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK13 and p38b

DIOPT Version :9

Sequence 1:NP_002745.1 Gene:MAPK13 / 5603 HGNCID:6875 Length:365 Species:Homo sapiens
Sequence 2:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster


Alignment Length:349 Identity:204/349 - (58%)
Similarity:263/349 - (75%) Gaps:5/349 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     9 FYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYREL 73
            |||.|:|:|.||:|:||.:...||.||||.||.|:.:.:..|||||||:|||||.:.|||.||||
  Fly     8 FYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYREL 72

Human    74 LLLKHMQHENVIGLLDVF---TPASSLRNFYDFYLVMPFMQTDLQKIM-GMEFSEEKIQYLVYQM 134
            .|||||.|||||||||||   .||.||..|...|:|...|..||..|: ..:.|::.:|:||||:
  Fly    73 RLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQKLSDDHVQFLVYQI 137

Human   135 LKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMH 199
            |:||||||||||:||||||.|:||||||||:||||||||.|::||||||.||||||||::|:|||
  Fly   138 LRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAESEMTGYVATRWYRAPEIMLNWMH 202

Human   200 YNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQ 264
            ||||.|||||||||||:|||:|||.|.|::.||..|::|.|.|..||:.:::.::|::||:|||.
  Fly   203 YNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESARNYIRSLPV 267

Human   265 TPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLE 329
            .||::|..:|..|:|.|.||||||||||.|||:||.|||.||:.|.:.||.:|..|.. :|.|.|
  Fly   268 MPRRNFRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKYHDPTDEQTAAL-YDQSFE 331

Human   330 HEKLTVDEWKQHIYKEIVNFSPIA 353
            ..:|.|::|::.::.|:..|.|.|
  Fly   332 ENELPVEKWREMVFSEVTAFKPTA 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK13NP_002745.1 STKc_p38delta 9..351 CDD:143384 202/345 (59%)
TXY 180..182 1/1 (100%)
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 202/345 (59%)
S_TKc 24..311 CDD:214567 179/286 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D324618at33208
OrthoFinder 1 1.000 - - FOG0000533
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X352
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.