DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK10 and p38a

DIOPT Version :9

Sequence 1:NP_001304998.1 Gene:MAPK10 / 5602 HGNCID:6872 Length:478 Species:Homo sapiens
Sequence 2:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster


Alignment Length:389 Identity:178/389 - (45%)
Similarity:252/389 - (64%) Gaps:34/389 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    39 MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQT 103
            ||.| :..:||.:::..:.:.:...||:|:|:||||.|.|..|.....:.:||||||:||||:..
  Fly     1 MSVS-ITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAV 64

Human   104 HAKRAYRELVLMKCVNHKNIISLLNVFTPQK---TLEEFQDVYLVMELMDANLCQVIQME-LDHE 164
            ||||.||||.|:|.::|:|:|.||::|.|..   :||.||.||||..||||:|..:|:|: |..:
  Fly    65 HAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDD 129

Human   165 RMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYY 229
            .:.:|:||:|.|:|::||||:||||||||||.|..||.|:||||||||.  |...||.||.||:|
  Fly   130 HVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARP--TENEMTGYVATRWY 192

Human   230 RAPEVILG-MGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKL-QP 292
            ||||::|. |.|.:.||||||||||.|::..:.||||.|:|.|.|.::|.||||..||:||: ..
  Fly   193 RAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSE 257

Human   293 TVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHP 357
            :.|:|:::.|...|.:|..:|.::        |.|    |.|||.|||.:|..|||:.::||.||
  Fly   258 SARSYIQSLPPMKGRSFKNVFKNA--------NPL----AIDLLEKMLELDAEKRITAEEALSHP 310

Human   358 YINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAV 421
            |:..:.:|:..:..||  ||...::.:..:::|||||||||.|.           :|.||.|.|
  Fly   311 YLEKYAEPSVEQTSPP--YDHSFEDMDLPVDKWKELIYKEVTNF-----------KPPPSYAQV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK10NP_001304998.1 STKc_JNK 63..398 CDD:270840 165/340 (49%)
S_TKc 64..359 CDD:214567 152/300 (51%)
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 170/371 (46%)
S_TKc 25..312 CDD:214567 152/300 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.