DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK10 and rl

DIOPT Version :9

Sequence 1:NP_001304998.1 Gene:MAPK10 / 5602 HGNCID:6872 Length:478 Species:Homo sapiens
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:389 Identity:148/389 - (38%)
Similarity:238/389 - (61%) Gaps:39/389 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    35 KHYNMSKSKVDNQFYSVEVGDSTFTVLK--------RYQNLKPIGSGAQGIVCAAYDAVLDRNVA 91
            :.:|.|.|.| |...|.||..|...|::        ||..|..||.||.|:|.:|.|.:.::.||
  Fly     2 EEFNSSGSVV-NGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVA 65

Human    92 IKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQV 156
            |||:| ||::||:.:|..||:.::....|:|||.:.::.... ::::.:|||:|..||:.:|.::
  Fly    66 IKKIS-PFEHQTYCQRTLREITILTRFKHENIIDIRDILRVD-SIDQMRDVYIVQCLMETDLYKL 128

Human   157 IQME-LDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAG----- 215
            ::.: |.::.:.|.|||:|.|:|::|||.::||||||||:::...|.|||.||||||.|.     
  Fly   129 LKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDH 193

Human   216 TSFMMTPYVVTRYYRAPEVIL-GMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQL 279
            |.| :|.||.||:|||||::| ..||.:::||||||||:.||:.::.:|||:.|:||.|.::..|
  Fly   194 TGF-LTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVL 257

Human   280 GTPCPEFMK-KLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVID 343
            |:|..:.:: .:....|||:|:.|....:.:.||||:    ||        :.|.|||.|||..:
  Fly   258 GSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPN----AD--------ALALDLLGKMLTFN 310

Human   344 PAKRISVDDALQHPYINVWYDPAE---VEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEK 404
            |.|||.|::||.|||:..:|||.:   .|.|    :...::..:.:.:..|.||::|.:..:|:
  Fly   311 PHKRIPVEEALAHPYLEQYYDPGDEPVAEVP----FRINMENDDISRDALKSLIFEETLKFKER 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK10NP_001304998.1 STKc_JNK 63..398 CDD:270840 136/345 (39%)
S_TKc 64..359 CDD:214567 126/302 (42%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 137/352 (39%)
S_TKc 38..326 CDD:214567 126/302 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.