DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf150a and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_001139044.1 Gene:rnf150a / 559804 ZFINID:ZDB-GENE-060213-1 Length:418 Species:Danio rerio
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:259 Identity:54/259 - (20%)
Similarity:96/259 - (37%) Gaps:83/259 - (32%)


- Green bases have known domain annotations that are detailed below.


Zfish   106 LIAKGNCTFREKIRHAAALNASAVVIFNVGSSNSNDTITMPHHGTGDVV---AIMIPEPKGREIM 167
            |:.:|.||:.:|...|..|....|:   ||.:.|..:..:.:....|.|   .:.||        
pombe   146 LVQRGKCTYFDKALEAQRLGFKGVI---VGDNRSPSSFRLHYMVAPDKVDESKVHIP-------- 199

Zfish   168 ALLEKNITVAMHISIGTRN-------------LQKYVSRTSV------VFVSISFIVLMIISLAW 213
                     ::.:|..:.|             |:.|.....:      ..:..|..::|:|::..
pombe   200 ---------SLFVSTSSYNLLWSDLLHSYRQPLKLYAKPEELGDMFWPFLLCFSPSIIMLITVQA 255

Zfish   214 LVFYYIQRF-RYANARDRSQRRLGDAAKKAISKLQVRTIRKGDKETDSDFDN------------- 264
            |.   |::| |....:.:::|.:.|...:.||       |:|....:.:.:|             
pombe   256 LA---IRKFIRTYRTKSKTRRFIEDLPSRTIS-------REGFYSEEEEIENSTQNGELVPLMDE 310

Zfish   265 ----------CAVCIEDYKPNDVVRILPCRHVFHRNCVDPWLQDHR-TCPMCKMNILKALGIPP 317
                      |.:|:|.:...|.|..|||:|.|||.|:..|:.|:| .||.|...      :||
pombe   311 STRRATFGVECVICLESFTKGDKVVALPCKHEFHRPCIAKWIVDYRHACPTCNTE------VPP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf150aNP_001139044.1 PA_GRAIL_like 45..180 CDD:239037 15/76 (20%)
UPF0233 <194..>219 CDD:299753 4/30 (13%)
zf-RING_2 263..306 CDD:290367 19/66 (29%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 54/259 (21%)
Peptidases_S8_S53 <144..211 CDD:299169 17/84 (20%)
zf-RING_2 320..362 CDD:290367 18/41 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I2160
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm34392
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.