DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK7 and bsk

DIOPT Version :9

Sequence 1:XP_006721620.1 Gene:MAPK7 / 5598 HGNCID:6880 Length:822 Species:Homo sapiens
Sequence 2:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster


Alignment Length:373 Identity:144/373 - (38%)
Similarity:214/373 - (57%) Gaps:33/373 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    46 DVTFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFK 110
            |..|.:...|..:..||:||.|:|.:|...:|.|.|||||:...|..||:|||..||.|::|...
  Fly    15 DTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVN 79

Human   111 HDNIIAIKDILRPTVPYGEFKSVPYGVPGYVVLDLMESDLHQIIHSSQPLTLEHVR--YFLYQLL 173
            |.|||.:.:...|.....||:.|      |:|::||:::|.|:|.    :.|:|.|  |.|||:|
  Fly    80 HKNIIGLLNAFTPQRNLEEFQDV------YLVMELMDANLCQVIQ----MDLDHDRMSYLLYQML 134

Human   174 RGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPEL 238
            .|:|::|||.:|||||||||::|..:|.|||.|||:||...|:     :.||.||.||:|||||:
  Fly   135 CGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTT-----FMMTPYVVTRYYRAPEV 194

Human   239 MLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAY 303
            :|.: .||:.:|:||||||.|||:....||||.:::.|...|:..||||||:.:|.: ...||.|
  Fly   195 ILGM-GYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRL-QPTVRNY 257

Human   304 IQSLPPRQPVPWETVYPGA-------------DRQALSLLGRMLRFEPSARISAAAALRHPFLAK 355
            :::.|......::.::|..             ...|.:||.:||..:|..|||...||:|.::..
  Fly   258 VENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINV 322

Human   356 YHDPDDEPDCAP-PFDFAFDREALTRERIKEAIVAEIEDFHARREGIR 402
            ::|.::....|| |:|.:.|....|.|:.||.|..|:.|:.|.....|
  Fly   323 WYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDYEAHNTNNR 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK7XP_006721620.1 STKc_ERK5 49..390 CDD:270842 139/356 (39%)
S_TKc 55..353 CDD:214567 127/312 (41%)
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 138/352 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.