DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK7 and p38a

DIOPT Version :9

Sequence 1:XP_006721620.1 Gene:MAPK7 / 5598 HGNCID:6880 Length:822 Species:Homo sapiens
Sequence 2:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster


Alignment Length:349 Identity:163/349 - (46%)
Similarity:230/349 - (65%) Gaps:18/349 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    49 FDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDN 113
            :::.|.|:.::.:|:||||.||.|..|.|...|||||:...|....:||||.|||::|||..|:|
  Fly    19 WEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHEN 83

Human   114 IIAIKDILRPTVPYG---EFKSVPYGVPGYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRG 175
            :|.:.||..|....|   .|:.|      |:|..||::||:.||. .|.|:.:||::.:||:|||
  Fly    84 VIGLLDIFHPHPANGSLENFQQV------YLVTHLMDADLNNIIR-MQHLSDDHVQFLVYQILRG 141

Human   176 LKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELML 240
            |||:|||.||||||||||:.|||:|||:|.|||:||     |.|::  ||.|||||||||||:||
  Fly   142 LKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLAR-----PTENE--MTGYVATRWYRAPEIML 199

Human   241 SLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQ 305
            :...|.|.:|:||||||..|::.||.||||.:::|||.|||.:||||....::.:.:|..|:|||
  Fly   200 NWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQ 264

Human   306 SLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPPFD 370
            ||||.:...::.|:..|:..|:.||.:||..:...||:|..||.||:|.||.:|..| ..:||:|
  Fly   265 SLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVE-QTSPPYD 328

Human   371 FAFDREALTRERIKEAIVAEIEDF 394
            .:|:...|..::.||.|..|:.:|
  Fly   329 HSFEDMDLPVDKWKELIYKEVTNF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK7XP_006721620.1 STKc_ERK5 49..390 CDD:270842 161/343 (47%)
S_TKc 55..353 CDD:214567 147/300 (49%)
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 163/349 (47%)
S_TKc 25..312 CDD:214567 147/300 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.