DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK7 and p38b

DIOPT Version :9

Sequence 1:XP_006721620.1 Gene:MAPK7 / 5598 HGNCID:6880 Length:822 Species:Homo sapiens
Sequence 2:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster


Alignment Length:351 Identity:162/351 - (46%)
Similarity:229/351 - (65%) Gaps:22/351 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    49 FDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDN 113
            :::.:.|:.::.:|.||||.|..|..|.|..:|||||:...|....:||||.|||::|||..|:|
  Fly    18 WEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYRELRLLKHMDHEN 82

Human   114 IIAIKDILRPTVP---YGEFKSVPYGVPGYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRG 175
            :|.:.|:..|..|   ..:|:.|      |:|..||::||:.||. :|.|:.:||::.:||:|||
  Fly    83 VIGLLDVFHPGQPADSLDQFQQV------YMVTHLMDADLNNIIR-TQKLSDDHVQFLVYQILRG 140

Human   176 LKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELML 240
            |||:|||.||||||||||:.|||:|||:|.|||:||     |||.:  ||.|||||||||||:||
  Fly   141 LKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLAR-----PAESE--MTGYVATRWYRAPEIML 198

Human   241 SLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQ 305
            :...|.|..|:||||||..|:|..|.||||.:::|||.|||.|||||:...:..:.:|..|.||:
  Fly   199 NWMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESARNYIR 263

Human   306 SLP--PRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPP 368
            |||  ||:  .:..::.||:..|:.||.:||..:...||:|..||.||::.|||||.|| ..|..
  Fly   264 SLPVMPRR--NFRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKYHDPTDE-QTAAL 325

Human   369 FDFAFDREALTRERIKEAIVAEIEDF 394
            :|.:|:...|..|:.:|.:.:|:..|
  Fly   326 YDQSFEENELPVEKWREMVFSEVTAF 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK7XP_006721620.1 STKc_ERK5 49..390 CDD:270842 160/345 (46%)
S_TKc 55..353 CDD:214567 147/302 (49%)
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 162/351 (46%)
S_TKc 24..311 CDD:214567 147/302 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.