DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK4 and p38b

DIOPT Version :9

Sequence 1:NP_002738.2 Gene:MAPK4 / 5596 HGNCID:6878 Length:587 Species:Homo sapiens
Sequence 2:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster


Alignment Length:325 Identity:120/325 - (36%)
Similarity:183/325 - (56%) Gaps:33/325 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    14 YDLGGRFVDFQPLGFGVNGLVLSAVDSRACRKVAVKKIA--LSDARSMKHALREIKIIRRLDHDN 76
            :::...:.:.||:|.|..|.|..||......|||:||:|  ...|...|...||:::::.:||:|
  Fly    18 WEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYRELRLLKHMDHEN 82

Human    77 IVKVYEVLGP-KGTDLQGELFKFSVAYIVQEYMETDLARLLEQGTLAEEHAKLFMYQLLRGLKYI 140
            ::.:.:|..| :..|   .|.:|...|:|...|:.||..::....|:::|.:..:||:|||||||
  Fly    83 VIGLLDVFHPGQPAD---SLDQFQQVYMVTHLMDADLNNIIRTQKLSDDHVQFLVYQILRGLKYI 144

Human   141 HSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYSHKGYLSEGLVTKWYRSPRLLLSPNN 205
            |||.|:||||||:||.:: ||..|:|.||||||..:...:  ||::    |:|||:|.::|:..:
  Fly   145 HSAGVIHRDLKPSNIAVN-EDCELRILDFGLARPAESEMT--GYVA----TRWYRAPEIMLNWMH 202

Human   206 YTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQLILETIPVIREEDKDEL-----------LRV 259
            |.:..|:|:.|||:||:||||.||.|...:.|:.||:|.:....:|....:           |.|
  Fly   203 YNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESARNYIRSLPV 267

Human   260 MPSFVSSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTS 324
            ||         :|..|.:....|..|||.|||:|..:...|:|||..|.||||..|..|.||.|:
  Fly   268 MP---------RRNFRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKYHDPTDEQTA 323

Human   325  324
              Fly   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK4NP_002738.2 STKc_MAPK4_6 14..351 CDD:143359 120/325 (37%)
SEG motif 186..188 0/1 (0%)
FRIEDE motif 328..333
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..413
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 499..534
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 120/325 (37%)
S_TKc 24..311 CDD:214567 113/305 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.