DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK4 and rl

DIOPT Version :9

Sequence 1:NP_002738.2 Gene:MAPK4 / 5596 HGNCID:6878 Length:587 Species:Homo sapiens
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:337 Identity:143/337 - (42%)
Similarity:208/337 - (61%) Gaps:30/337 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    14 YDLGGRFVDFQPLGFGVNGLVLSAVDSRACRKVAVKKIALSDARS-MKHALREIKIIRRLDHDNI 77
            :::|.|::....:|.|..|:|:||.|:...::||:|||:..:.:: .:..||||.|:.|..|:||
  Fly    32 FEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENI 96

Human    78 VKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGTLAEEHAKLFMYQLLRGLKYIHS 142
            :.:.::|.....|...::      ||||..|||||.:||:...|:.:|...|:||:|||||||||
  Fly    97 IDIRDILRVDSIDQMRDV------YIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHS 155

Human   143 ANVLHRDLKPANIFIS-TEDLVLKIGDFGLARIVDQHYSHKGYLSEGLVTKWYRSPRLLLSPNNY 206
            ||||||||||:|:.:: |.|  |||.|||||||.|..:.|.|:|:|.:.|:|||:|.::|:...|
  Fly   156 ANVLHRDLKPSNLLLNKTCD--LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGY 218

Human   207 TKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQLILETIPVIREEDKDEL-----------LRVM 260
            ||:||:|:.||||||||:.|.:|.|.|.|:|:..||   .|:....:|:|           |..:
  Fly   219 TKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHIL---GVLGSPSRDDLECIINEKARNYLESL 280

Human   261 PSFVSSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQ 325
            |      ::...|..||.|..::.|:|.|.|:|||||..|:..|..|.|||:..|..|.|||.::
  Fly   281 P------FKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAE 339

Human   326 HPFRIEDEIDDI 337
            .||||..|.|||
  Fly   340 VPFRINMENDDI 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK4NP_002738.2 STKc_MAPK4_6 14..351 CDD:143359 143/337 (42%)
SEG motif 186..188 0/1 (0%)
FRIEDE motif 328..333 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..413
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 499..534
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 143/337 (42%)
S_TKc 38..326 CDD:214567 127/304 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.