DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acanb and lectin-22C

DIOPT Version :9

Sequence 1:XP_021326217.1 Gene:acanb / 559593 ZFINID:ZDB-GENE-100422-16 Length:1376 Species:Danio rerio
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:253 Identity:54/253 - (21%)
Similarity:100/253 - (39%) Gaps:68/253 - (26%)


- Green bases have known domain annotations that are detailed below.


Zfish  1052 SISVSNS-TSHESNDLLPERDEKISVTMEAFDVTDKSPLITTPTNIPVLTTPSSASLQMPKSTMN 1115
            |.:::|| .|.::|::|..:     .|||.    ..:.|.....:|.|........|.:.:....
  Fly    55 SQNLANSNNSSKANEVLVRQ-----YTMEG----QLTALQNKQLSIEVALDAQGRKLNVNEQNFT 110

Zfish  1116 PSVNEAPSDPCDPNPCGQGLCS-LQDGVALCQCHSGFSGENCSVLVQGCAEGWMEFMGSCYIHFD 1179
            ..:|           |.:|:.| |:..|...:....:.|              .|.:||.|.:.:
  Fly   111 ERLN-----------CMEGILSALEKTVLEVKTKIKYLG--------------FEQIGSKYYYIE 150

Zfish  1180 E--RETWTSAEQHCQELNSHLVSISSQQEQEFVKTQAQD--YQWIGLNDKDVQNEF--------- 1231
            :  .:.|::|.:.|:.:..||..|..:.:...:|...::  :.|:|:||.|.:.:|         
  Fly   151 KVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQT 215

Zfish  1232 ---RWTDGSPLEYENWRPNQPDNYFSTGEDCVVMIWHENGQWNDVPCNYHLPFTCKSE 1286
               :|..|        ||:|.|..     :||.:.   ||:..|.||:|...|.|::|
  Fly   216 TFLKWASG--------RPSQLDTL-----NCVFLY---NGEMYDYPCHYTFRFICQTE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acanbXP_021326217.1 Ig 45..159 CDD:325142
Link_domain_CSPGs_modules_1_3 158..252 CDD:239594
Link_domain_CSPGs_modules_2_4 260..354 CDD:239597
Xlink 459..553 CDD:306661
Link_domain_CSPGs_modules_2_4 560..655 CDD:239597
CLECT 1163..1284 CDD:321932 32/136 (24%)
CCP 1290..1347 CDD:153056
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 29/124 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.