DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZMAT5 and CG31922

DIOPT Version :9

Sequence 1:NP_001003692.1 Gene:ZMAT5 / 55954 HGNCID:28046 Length:170 Species:Homo sapiens
Sequence 2:NP_722687.1 Gene:CG31922 / 319028 FlyBaseID:FBgn0051922 Length:139 Species:Drosophila melanogaster


Alignment Length:181 Identity:47/181 - (25%)
Similarity:74/181 - (40%) Gaps:56/181 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     2 GKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQC 66
            ||.|:||||....:::|:.||.|..|:.|..||..:...:.|...||.:|:.|.||::: ....|
  Fly     3 GKSYYCDYCCCFLKNDLNVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEERQKTPCKRY-FGSYC 66

Human    67 DFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEP 131
            .|.:.|:|:|.|..:|:|                         ||..:..|.||.|...:::.: 
  Fly    67 KFETYCKFTHYSGDNLRE-------------------------LEKLVLARKKRKSRKKTNKCK- 105

Human   132 IRTTVFQYPVGWP----PVQELPPSLRAPPPGGWPLQP--------RVQWG 170
                      .||    ..:.|||||:       |:.|        .:.||
  Fly   106 ----------RWPWKTHLRKGLPPSLQ-------PINPEKLKQTDFELSWG 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZMAT5NP_001003692.1 zf-U1 4..>46 CDD:389966 14/41 (34%)
zf-CCCH 55..76 CDD:395517 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..170 6/27 (22%)
CG31922NP_722687.1 zf-U1 3..39 CDD:277622 15/35 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152621
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5136
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5341
Isobase 1 0.950 - 0 Normalized mean entropy S7282
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1541869at2759
OrthoFinder 1 1.000 - - FOG0007275
OrthoInspector 1 1.000 - - oto89587
orthoMCL 1 0.900 - - OOG6_106589
Panther 1 1.100 - - LDO PTHR16465
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5190
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.