DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK3 and bsk

DIOPT Version :9

Sequence 1:NP_002737.2 Gene:MAPK3 / 5595 HGNCID:6877 Length:379 Species:Homo sapiens
Sequence 2:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster


Alignment Length:357 Identity:144/357 - (40%)
Similarity:222/357 - (62%) Gaps:31/357 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    36 FDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKIS-PFEHQTYCQRTLREIQILLRFRHEN 99
            |.:..||..|:.||.||.|:|.:|||.:.:..|||||:| ||::.|:.:|..||.:::....|:|
  Fly    18 FTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKN 82

Human   100 VIGIRDILRAST----LEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSA 160
            :||   :|.|.|    ||..:|||:|.:||:.:|.:::: ..|.:|.:.|.|||:|.|:|::|||
  Fly    83 IIG---LLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQ-MDLDHDRMSYLLYQMLCGIKHLHSA 143

Human   161 NVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKS 225
            .::||||||||:::...|.|||.||||||.|..    |..:|.||.||:|||||::| ..|||::
  Fly   144 GIIHRDLKPSNIVVKADCTLKILDFGLARTAGT----TFMMTPYVVTRYYRAPEVIL-GMGYTEN 203

Human   226 IDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKV 290
            :||||||||:.||:....:|||..::||.|.|:..||:||...:. .:....|||:::.|..|..
  Fly   204 VDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQ-RLQPTVRNYVENRPRYTGY 267

Human   291 AWAKLFP-------------KSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYD--PTDEP 340
            ::.:|||             :..|.|.:||.:||..:|.:||:|:|||.|.|:..:||  ..|.|
  Fly   268 SFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAP 332

Human   341 VAEEPFTFAMELDDLPKERLKELIFQETARFQ 372
             |.||:..:::..:...|:.||||::|...::
  Fly   333 -APEPYDHSVDEREHTVEQWKELIYEEVMDYE 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK3NP_002737.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
STKc_ERK1_2_like 36..370 CDD:270839 144/353 (41%)
TXY 202..204 1/1 (100%)
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 142/346 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.