DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPK3 and p38b

DIOPT Version :9

Sequence 1:NP_002737.2 Gene:MAPK3 / 5595 HGNCID:6877 Length:379 Species:Homo sapiens
Sequence 2:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster


Alignment Length:346 Identity:162/346 - (46%)
Similarity:239/346 - (69%) Gaps:18/346 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    36 FDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKIS-PFEHQTYCQRTLREIQILLRFRHEN 99
            :::...|..||.:|:||||.|..|......|:|||||:: ||:...:.:||.||:::|....|||
  Fly    18 WEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHAKRTYRELRLLKHMDHEN 82

Human   100 VIGIRDILR----ASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSA 160
            |||:.|:..    |.:|:..:.||:|..||:.||..::::|:||:||:.:.:|||||||||||||
  Fly    83 VIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQKLSDDHVQFLVYQILRGLKYIHSA 147

Human   161 NVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKS 225
            .|:||||||||:.:|..|:|:|.||||||.|:.|      :|.|||||||||||||||...|.::
  Fly   148 GVIHRDLKPSNIAVNEDCELRILDFGLARPAESE------MTGYVATRWYRAPEIMLNWMHYNQT 206

Human   226 IDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKV 290
            .||||||||:||:|:.|.:|||..::.|||.|:.:||:|:.|.::.|.:..||||::|||...:.
  Fly   207 ADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESARNYIRSLPVMPRR 271

Human   291 AWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVA---EEPFTFAMEL 352
            .:..:|..::..|:|||::||..:.:||||.|:||||||:|:|:|||||..|   ::.|    |.
  Fly   272 NFRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHPYMEKYHDPTDEQTAALYDQSF----EE 332

Human   353 DDLPKERLKELIFQETARFQP 373
            ::||.|:.:|::|.|...|:|
  Fly   333 NELPVEKWREMVFSEVTAFKP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPK3NP_002737.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
STKc_ERK1_2_like 36..370 CDD:270839 160/341 (47%)
TXY 202..204 1/1 (100%)
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 161/344 (47%)
S_TKc 24..311 CDD:214567 143/292 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.