DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRKG1 and CG12069

DIOPT Version :9

Sequence 1:NP_006249.1 Gene:PRKG1 / 5592 HGNCID:9414 Length:686 Species:Homo sapiens
Sequence 2:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster


Alignment Length:307 Identity:123/307 - (40%)
Similarity:178/307 - (57%) Gaps:10/307 - (3%)


- Green bases have known domain annotations that are detailed below.


Human   372 LSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFI 436
            |.|:.|..|||.|.||:|:||: :.|....:|.|.|.|..||.|:|..|:.|||.:::.......
  Fly    44 LDDYEIKATLGSGSFGKVQLVR-ERESGVYYASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNT 107

Human   437 VRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLK 501
            |.|..::||...||:::....||||:|..|....|.:...|||.|.|..|..|||...::|||||
  Fly   108 VNLIASYKDFDSLYLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLK 172

Human   502 PENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYEL 566
            |||:::|..||.|:.|||||||:  ..:|.|.||||||:.||||.:|.:..|.|:|:.|:|::|.
  Fly   173 PENIMMDKNGYLKVTDFGFAKKV--ETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEF 235

Human   567 LTGSPPFS--GPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQ 629
            :.|..|||  ..|.|..||.|...  ..:.|...:....:|:..|.:.:.|:|.|||.||.:||:
  Fly   236 VAGHSPFSAHNRDVMSMYNKICEA--DYKMPSYFSGALRHLVDHLLQVDLSKRFGNLINGNRDIK 298

Human   630 KHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPP 676
            :|:||:...|..|...|:..|.:|::::|.|.||||..   :|:|.|
  Fly   299 EHEWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFDKV---SDKPRP 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRKG1NP_006249.1 DD_cGKI-beta 4..55 CDD:213375
CAP_ED 118..227 CDD:237999
CAP_ED 237..341 CDD:237999
STKc_cGK 381..641 CDD:270724 106/261 (41%)
S_TK_X 636..>679 CDD:214529 14/41 (34%)
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 123/307 (40%)
PKc_like 45..335 CDD:304357 118/294 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.