DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lingo4b and Fili

DIOPT Version :9

Sequence 1:NP_001082850.1 Gene:lingo4b / 559074 ZFINID:ZDB-GENE-091214-3 Length:604 Species:Danio rerio
Sequence 2:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster


Alignment Length:416 Identity:128/416 - (30%)
Similarity:191/416 - (45%) Gaps:52/416 - (12%)


- Green bases have known domain annotations that are detailed below.


Zfish     5 LCGQRGAWTVLLLWCLNLSAADLP------CPQRCSCSRDPLEVN----CSSRHLTAVPEGLPTN 59
            ||   ||..||||  |.|:...||      ||.:|.|...  |.|    |....|..||..|...
  Fly    17 LC---GAIPVLLL--LLLTLVILPPETTAFCPSKCQCLGG--EANSRALCVDAALEDVPIQLNPE 74

Zfish    60 AKRLDLSGNQLKTLARRQFS--SLSKLEDLDLSENIISMIEVETFQGLKNLRYLRIKNNRLKILP 122
            .|.::|:.|:::||   :||  ...|||.||||:|||..:..:.|:....||.|.:..|.:..|.
  Fly    75 TKYINLTVNRIRTL---EFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLH 136

Zfish   123 VGVFSGLSNLRRLDISENEILVFLDYTFRDMINLQQLDAGENDLVFISQRAFVGLQALKELNVDR 187
            ...|.||:||..||:|.|.|.........|:.:|.:||...|::|.:....|.|:..|:.|....
  Fly   137 KHAFKGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRN 201

Zfish   188 SNLTSIPTEALSQLQSLTKLRLRKLTISVLPNNAFRRLHQLRTLQILHWSSLEMLNSNSLVGL-N 251
            :.|..:|...|..|.:|..|.:....:..:.|::|..|.:|..|.: ..:.:..|:.::..|| :
  Fly   202 NRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSV-QGNVMSELDLSAFEGLIS 265

Zfish   252 LTTLVLTNCNLSAIPYSPLRHLAYLQYLDLSYNPITSIQGNLLGDLLRLQELHLVGGNLL-RIEP 315
            |..|.|::.||:.:|...|..|:.|.||:|..|..:.:......:|..|:||||...:.| ||:.
  Fly   266 LKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDS 330

Zfish   316 GAFRGLSRFRLLNVS-------------------------SNRLSTLEESAFHSVGNLQTLRLDR 355
            .||...:..:.|:::                         ||.|.||..:.| .|..||.|.|..
  Fly   331 RAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQF-PVDQLQKLYLGD 394

Zfish   356 NPLACDCRLLWVMRRRRRLDFDGRQP 381
            |||.|:|.|||:.|.... :|:|..|
  Fly   395 NPLQCNCSLLWLWRLVTG-NFEGVDP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lingo4bNP_001082850.1 LRRNT 28..61 CDD:214470 12/42 (29%)
leucine-rich repeat 41..62 CDD:275380 7/24 (29%)
LRR <56..304 CDD:227223 74/250 (30%)
leucine-rich repeat 63..83 CDD:275380 6/21 (29%)
leucine-rich repeat 84..107 CDD:275380 10/22 (45%)
leucine-rich repeat 108..131 CDD:275380 8/22 (36%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..179 CDD:275380 7/22 (32%)
leucine-rich repeat 180..203 CDD:275380 6/22 (27%)
leucine-rich repeat 204..251 CDD:275380 10/47 (21%)
leucine-rich repeat 228..250 CDD:275380 3/21 (14%)
leucine-rich repeat 252..275 CDD:275380 8/22 (36%)
leucine-rich repeat 276..297 CDD:275380 5/20 (25%)
LRR_8 299..358 CDD:316378 23/84 (27%)
leucine-rich repeat 300..321 CDD:275380 10/21 (48%)
leucine-rich repeat 324..344 CDD:275380 7/44 (16%)
I-set 415..498 CDD:254352
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 7/24 (29%)
leucine-rich repeat 98..121 CDD:275380 10/22 (45%)
LRR_8 120..180 CDD:404697 20/59 (34%)
leucine-rich repeat 122..145 CDD:275380 8/22 (36%)
leucine-rich repeat 146..169 CDD:275380 7/22 (32%)
LRR <161..>354 CDD:227223 49/193 (25%)
leucine-rich repeat 170..193 CDD:275380 7/22 (32%)
leucine-rich repeat 194..217 CDD:275380 6/22 (27%)
leucine-rich repeat 218..265 CDD:275380 10/47 (21%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
leucine-rich repeat 314..338 CDD:275380 10/23 (43%)
LRR_8 337..397 CDD:404697 13/60 (22%)
leucine-rich repeat 339..360 CDD:275380 1/20 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.