DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MESP1 and Fer1

DIOPT Version :9

Sequence 1:NP_061140.1 Gene:MESP1 / 55897 HGNCID:29658 Length:268 Species:Homo sapiens
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:186 Identity:49/186 - (26%)
Similarity:77/186 - (41%) Gaps:55/186 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    71 RRGARSSRLG-----SGQRQSASEREKLRMRTLARALHELRRFLPPSVAPAGQSLTKIETLRLAI 130
            ||..:..||.     :.|||:|:.||:.||:::..|...||..:|  ..|..:.|:|::||:|||
  Fly    70 RRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIP--TLPYEKRLSKVDTLKLAI 132

Human   131 RYIGHLSAVL---------GLSEESLQRRCRQRGDAGSPRGCPLCPDDCPAQMQTRTQAEGQGQG 186
            .||..||.::         ||   ||||..::               :.|.::..:.:..|....
  Fly   133 SYITFLSEMVKKDKNGNEPGL---SLQRNYQK---------------EPPKKIILKDRTGGVAHS 179

Human   187 RGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAMEPSPPSPL 242
                 :|..|.|..:      ||::          |:|....||......|.|.||
  Fly   180 -----LSWYRKGDRY------PGSK----------LYARTWTPEDPRGPHSQPLPL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MESP1NP_061140.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..93 10/26 (38%)
bHLH_TS_Mesp 83..147 CDD:381508 26/72 (36%)
CPLCP 163..167 0/3 (0%)
2 X 2 AA tandem repeats of G-Q 182..185 1/2 (50%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.