DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fosl2 and kay

DIOPT Version :9

Sequence 1:NP_001076467.1 Gene:fosl2 / 558921 ZFINID:ZDB-GENE-070209-164 Length:341 Species:Danio rerio
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:381 Identity:105/381 - (27%)
Similarity:153/381 - (40%) Gaps:108/381 - (28%)


- Green bases have known domain annotations that are detailed below.


Zfish     8 TYDTSSRGSSSSPAHPDTSPIPASSYQKYRIDMPGSSSA-----FIPTINAITTSQDLQWMVQPT 67
            |.||||       ||.|     ::|||...| |.||.:.     |...:.|:::|:.        
  Fly   340 TTDTSS-------AHTD-----STSYQAGHI-MAGSVNGGGVNNFSNVLAAVSSSRG-------- 383

Zfish    68 VITSMSNPYSRPHPYGLSVSSGPSLLGHTALTRPGVIRSIGDARGRR-KRDEQLTPEEEEKRRVR 131
                           ..||.|..:...:|...|.|         ||| .|...:|||||:||.||
  Fly   384 ---------------SASVGSSNANTSNTPARRGG---------GRRPNRSTNMTPEEEQKRAVR 424

Zfish   132 RERNKLAAAKCRNRRRELTEMLQGETEKLEEEKADLQKEIETLQKEKDKLEFMLVAHNPVCK--- 193
            |||||.|||:||.||.:.|..|..|.|:||:....::||||.|...|::||::|..|...|:   
  Fly   425 RERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIR 489

Zfish   194 ------------LPP---------------EERHQSSHSQ------QCVPLPLTMRSN----LVP 221
                        :.|               ...|.|:.|.      ....|..|.|||    |.|
  Fly   490 SDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTGRSNSPLDLKP 554

Zfish   222 RGPMNTLNPVVVKQEPLED--DDDDEDDDDEEEKVQHSVIKPICLGGGMYCSDGDSLNTPVVAAS 284
            ...:::| .:.:|.|||:.  |.....|.|.....:...:.|:.....::.|   ::.||..|:|
  Fly   555 AANIDSL-LMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHVHLS---TILTPTGASS 615

Zfish   285 TPVSTPNNPSLIFTYPSMLEPESPSPSSESCSKAHRRSSSSGDQSSDSLNSPTLLA 340
            ..:.||    :..|.|.......|..|:.|       |.::.:...:::|||||.|
  Fly   616 GSLQTP----ITSTAPGGFGSAFPVTSNGS-------SINNINSIGNNMNSPTLNA 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fosl2NP_001076467.1 bZIP_Fos 135..188 CDD:269869 24/52 (46%)
coiled coil 135..187 CDD:269869 24/51 (47%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 31/60 (52%)
coiled coil 421..480 CDD:269869 30/58 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10618
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24837
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.