DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment macroh2a2 and His2A:CG33832

DIOPT Version :10

Sequence 1:NP_001020673.1 Gene:macroh2a2 / 558711 ZFINID:ZDB-GENE-050913-114 Length:367 Species:Danio rerio
Sequence 2:NP_001027331.1 Gene:His2A:CG33832 / 3772632 FlyBaseID:FBgn0053832 Length:124 Species:Drosophila melanogaster


Alignment Length:119 Identity:80/119 - (67%)
Similarity:92/119 - (77%) Gaps:2/119 - (1%)


- Green bases have known domain annotations that are detailed below.


Zfish     1 MSAR--GGKKKITKLSRSARAGVIFPVGRMMRYLRTGTHKYRIGMGAPVYMAAVIEYLAAEILEL 63
            ||.|  |||.|....|||.|||:.|||||:.|.||.|.:..|:|.|||||:|||:||||||:|||
  Fly     1 MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65

Zfish    64 AGNAARDNKKGRITPRHIKLAVANDEELNQLLRGVTISNGGVLPRIHPELLSKK 117
            ||||||||||.||.|||::||:.||||||:||.||||:.|||||.|...||.||
  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
macroh2a2NP_001020673.1 H2A 14..119 CDD:197711 73/104 (70%)
Macro_H2A-like 173..363 CDD:394875
His2A:CG33832NP_001027331.1 PTZ00017 16..124 CDD:185399 73/104 (70%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.