DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A11 and CG33233

DIOPT Version :9

Sequence 1:NP_060954.1 Gene:SLC22A11 / 55867 HGNCID:18120 Length:550 Species:Homo sapiens
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:468 Identity:98/468 - (20%)
Similarity:183/468 - (39%) Gaps:136/468 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   114 VDGWVYDRSVFTSTIVAKWDLVCSSQGL------KPLSQSIFMSGILVGSFIWGLLSYRFGRKPM 172
            |..::|..|| |.::.|.:.:|.:|...      |.|..:..:.|::......|.|:.|:|||  
  Fly    25 VSFFIYMYSV-TESMTAGYLVVLTSCEFDTSPKEKTLLANSLLGGMVASGLFIGFLADRYGRK-- 86

Human   173 LSWCCLQLAVAGT---STIFA--PTFVIYCGLRFVAAFGMAGIFLSSLTLM----------VEWT 222
               ..::||:.|.   |.|.|  |.......:|.:     .|.|||::..:          ::| 
  Fly    87 ---FVIRLALVGALSFSVISALMPDLYSLSVIRII-----VGTFLSAVASLQVGFLGEFHAIKW- 142

Human   223 TTSRRAVTMTVVGCAFSAGQA-------ALGGL----------AFALRDWRTLQLAASVPFFAIS 270
                |.:|:.:  |:.|.|.|       |:..|          ::.||.||.|.:     ||   
  Fly   143 ----RPITVAI--CSQSQGLALIYCPLVAMAILPNNFNVDLSSSYNLRVWRFLMM-----FF--- 193

Human   271 LISWWL--------PESARWLIIKGKPDQALQELRKVARINGHK-EAKNLTIEVLMSSVKEEVAS 326
            :|..||        ||:..:|:...:||:||..|:.:.|:|..| |..::|:....||..::...
  Fly   194 MIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRKKWEDVDITLSEEKSSTNDQEGF 258

Human   327 AK----EPRSVLDLFCVP-VLRWRSCAMLVVNFSLLISYYGL------VFDLQSLGRDIF----- 375
            .|    |.:.   ||..| |.::..|..|:  |.:..:..||      :.::.:.|.:..     
  Fly   259 WKTVWYEYKL---LFSKPHVFKFFICLFLI--FGIFFTSIGLGIWFPVIRNMDNSGSNRLCDLVN 318

Human   376 -----------------------------LLQALFGAVDFLGRATTA-LLLSFLGRRTIQAGSQA 410
                                         |:..::....::|....| :|:.::.|:.:.|    
  Fly   319 NNPTFINHEADDTNGTDSESPKCNDEMTNLIDPVYYGFTYIGCFILASVLVHWMTRKYVIA---- 379

Human   411 MAGLAILANMLVPQDLQ-----TLRVVFAVLGKGCFGISLTCLTIYKAELFPTPVRMTADGILHT 470
               |.||.:|::...|.     |:.::|.||.....|:.:...|....:..|..:|..|..::.:
  Fly   380 ---LHILISMILGISLNIMKQPTVVLIFFVLMMVLPGVLIPLATSVLVDCLPVNLRGKALCMVRS 441

Human   471 VGRLGAMMGPLIL 483
            :.|.|.::|..::
  Fly   442 LARFGGVLGSTMI 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A11NP_060954.1 Sugar_tr 11..523 CDD:331684 98/468 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..550
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 97/463 (21%)
MFS 23..>208 CDD:119392 48/208 (23%)
MFS 354..>482 CDD:304372 22/108 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.