DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lrit3a and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_001122166.1 Gene:lrit3a / 558559 ZFINID:ZDB-GENE-080723-63 Length:636 Species:Danio rerio
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:497 Identity:99/497 - (19%)
Similarity:160/497 - (32%) Gaps:201/497 - (40%)


- Green bases have known domain annotations that are detailed below.


Zfish    31 GRSDGTGSRSVLCNDPDMSDIPVNVPLD---TVKL---------------RVEKTAVRRVPTEA- 76
            |...|:...:|:..||:.:|:..|:.:.   .|||               ..|::|:..|.... 
  Fly    37 GNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVI 101

Zfish    77 -------------------FYYLSEL------RYLWITYNSITSVDPGSFYNLKVLHELRLD--- 113
                               |.:::.:      ||: ...|::|:.....|  :||:....:|   
  Fly   102 TRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYM-CQINTVTAKTQYGF--VKVVVPPNIDDAL 163

Zfish   114 --------------------GNMIATFPW--ESLKEMPSLKTLDLHNNRLTSVPVEAAPYLINIT 156
                                |:...|..|  :...::...|||::|:....|:.:|....|....
  Fly   164 TSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGA 228

Zfish   157 YLDISSNKLTTLPSDLVDIWPPFSGIQPSANTSQKTVLGLQDNPWYCDCRISKLIELSKMAGIPV 221
            ||.|:||                 |:.||.:.                 ||...::.|.|..|  
  Fly   229 YLCIASN-----------------GVPPSVSK-----------------RIKVSVDFSPMVWI-- 257

Zfish   222 VLMDQVLTCSGPEHLSGVLFQRAELDQCVKPTVMTSATKITSPLGSNVLLRCDANGFPTPTLLWT 286
                       |..|.|:                        |:|.|:.|.|.....||....||
  Fly   258 -----------PHQLVGI------------------------PIGFNITLECFIEANPTSLNYWT 287

Zfish   287 TADGSVVNNTVVQES--------PGE-----GVRWSILSLHSIVFKDAGDYRCKAKNVAGNAEAY 338
            ..     |:.::.||        ||.     .:|.:|.::.|   .|.|:|:|.|||..|:.:..
  Fly   288 RE-----NDQMITESSKYKTETIPGHPSYKATMRLTITNVQS---SDYGNYKCVAKNPRGDMDGN 344

Zfish   339 ITLSVDGVQPTTPFPPINITKQPEDQPTTTFTPTKMPLFTSLSPITITTRPVMTTMPPLTTR--- 400
            |.|.:.  .|.|..||          ||||                 |.|...||...:...   
  Fly   345 IKLYMS--SPPTTQPP----------PTTT-----------------TLRRTTTTAAEIALDGYI 380

Zfish   401 KSPIPGGGVQRSPPAGDKPAKVQQSKNGKGSIK-KSDIRDIE 441
            .:|:.|.|:   ...|:.|.. ....:||.||| .|::.:|:
  Fly   381 NTPLNGNGI---GIVGEGPTN-SVIASGKSSIKYLSNLNEID 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lrit3aNP_001122166.1 LRR_8 81..141 CDD:290566 15/90 (17%)
leucine-rich repeat 83..106 CDD:275378 5/28 (18%)
LRR_4 107..145 CDD:289563 9/62 (15%)
leucine-rich repeat 107..130 CDD:275378 4/47 (9%)
LRR_8 129..>171 CDD:290566 12/41 (29%)
LRR_4 129..170 CDD:289563 12/40 (30%)
leucine-rich repeat 131..154 CDD:275378 7/22 (32%)
leucine-rich repeat 155..168 CDD:275378 5/12 (42%)
TPKR_C2 199..249 CDD:301599 8/49 (16%)
Ig 252..343 CDD:299845 27/103 (26%)
IG_like 261..343 CDD:214653 27/94 (29%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 15/98 (15%)
Ig 69..139 CDD:143165 9/70 (13%)
IG_like 165..249 CDD:214653 20/117 (17%)
IGc2 172..237 CDD:197706 15/81 (19%)
IG_like 267..348 CDD:214653 25/88 (28%)
Ig 270..339 CDD:299845 21/76 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.