DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lrit3a and dpr3

DIOPT Version :9

Sequence 1:	NP_001122166.1	Gene:	lrit3a / 558559	ZFINID:	ZDB-GENE-080723-63	Length:	636	Species:	Danio rerio
Sequence 2:	NP_001014459.2	Gene:	dpr3 / 3346208	FlyBaseID:	FBgn0053516	Length:	522	Species:	Drosophila melanogaster

Alignment Length:	118	Identity:	26/118 - (22%)
Similarity:	45/118 - (38%)	Gaps:	24/118 - (20%)

- Green bases have known domain annotations that are detailed below.

Zfish   389 PVMTTMPPLTTRKSPIPGGGVQRSPPAGDKPAKVQQSKNGKGSIKKSDIRDIEVVEETTETAVLL 453
            |.::|....:..:||        ||||....|   .|.:...|...:.....|....|.::...|
  Fly   147 PTLSTFLSSSQSQSP--------SPPAASASA---SSPSSFSSFAVAHGPQTEATNHTFKSLAFL 200

Zfish   454 WSAEGLPSDTPLTVVYFPYDAK------DDKETVDTEVGQGKLLLEYLMPNQV 500
            .::.|  ||     ::...|||      .|:|:.|.:..|...:.::.||..:
  Fly   201 DASFG--SD-----LFAQTDAKRERSGAADEESQDADTSQSLPIFDFGMPRNI 246

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lrit3a	NP_001122166.1	LRR_8	81..141	CDD:290566
		leucine-rich repeat	83..106	CDD:275378
		LRR_4	107..145	CDD:289563
		leucine-rich repeat	107..130	CDD:275378
		LRR_8	129..>171	CDD:290566
		LRR_4	129..170	CDD:289563
		leucine-rich repeat	131..154	CDD:275378
		leucine-rich repeat	155..168	CDD:275378
		TPKR_C2	199..249	CDD:301599
		Ig	252..343	CDD:299845
		IG_like	261..343	CDD:214653
dpr3	NP_001014459.2	Ig	243..330	CDD:299845	1/4 (25%)
		IG_like	243..329	CDD:214653	1/4 (25%)
		Ig	350..464	CDD:299845
		IG_like	<441..477	CDD:214653
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900