DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BRK1 and HSPC300

DIOPT Version :10

Sequence 1:NP_060932.2 Gene:BRK1 / 55845 HGNCID:23057 Length:75 Species:Homo sapiens
Sequence 2:NP_726400.1 Gene:HSPC300 / 246497 FlyBaseID:FBgn0061198 Length:76 Species:Drosophila melanogaster


Alignment Length:76 Identity:56/76 - (73%)
Similarity:67/76 - (88%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAG-QEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYI 64
            |:| ..:.:|::||||||||||||:||:|||:|.|||||||||||||||.||||||.|||||:|:
  Fly     1 MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKLTILERRIDYL 65

Human    65 EARVTKGETLT 75
            ||.|.:|||||
  Fly    66 EACVAQGETLT 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BRK1NP_060932.2 None
HSPC300NP_726400.1 CCDC53 34..>67 CDD:462967 27/32 (84%)

Return to query results.
Submit another query.