DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WWC3 and Nedd4

DIOPT Version :9

Sequence 1:NP_056506.2 Gene:WWC3 / 55841 HGNCID:29237 Length:1092 Species:Homo sapiens
Sequence 2:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster


Alignment Length:503 Identity:101/503 - (20%)
Similarity:171/503 - (33%) Gaps:173/503 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   599 NG-DPQIHVGLLRDSGSEC-LLVHVLQLKNPAGLAVKEDCKVHIRVYLPPLDSGTPN--TYCSKA 659
            || .|:..:..:.|||..| |.:.||..::.|...:......::|:.|..: :|..|  :..:|.
  Fly    52 NGYTPRRSLAAVNDSGDSCHLRIVVLTGQSLAKKDIFGASDPYVRIDLNTI-NGDINIDSVLTKT 115

Human   660 LEFQVPLVFNE--VFRIPVHSSALTLKSLQLYVCSVTPQLQEELLGIAQINLADYDSLSEMQLRW 722
            .:..:...:||  :||:......|..:     |.......:::.||:.::.|.:..  :|.:.|.
  Fly   116 KKKTLNPTWNEEFIFRVKPSEHKLVFQ-----VFDENRLTRDDFLGMVELTLVNLP--TEQEGRT 173

Human   723 HSVQVFT-----------------------------SSEPSRTR--------EAGCAGESSARD- 749
            ...|.:|                             .||||...        ||..|||:||:. 
  Fly   174 IGEQSYTLRPRRSVGAKSRIKGTLRIYHAFIRETREQSEPSSGNSDGEWEHVEATNAGETSAQPH 238

Human   750 ----------PA----------------HTISISGKTDAVTVLLARTTAQLQAVERELAEERAKL 788
                      ||                ||...: :.|..|||.:.::   |:.:.:||.:..:.
  Fly   239 PFPTGGHDALPAGWEERQDANGRTYYVNHTARTT-QWDRPTVLNSHSS---QSTDDQLASDFQRR 299

Human   789 EYTEEEVLEMERKEEQAEAISERSWQADSVDSGC-----SNCTQTSPPYPEPCCMGIDSILGHPF 848
            .:...:..|..|   .|::||..|.:.::..:|.     :..|.::||.......||       .
  Fly   300 FHISVDDTESGR---SADSISHNSIEDNNNAAGLAYTPKTAATSSAPPNTPTNNNGI-------L 354

Human   849 AAQAGPYSPEKFQ-PSPLKVDKETNTEDLFLE------------EAASLVKE-RPSRRARG---- 895
            |..|..|..|:.| |:   ||   :|..::..            .|.||..: ||.|.|.|    
  Fly   355 AQIAMQYRAEEDQDPT---VD---HTSFVYNSLRHPVAHRQPEISATSLQNDLRPVREAPGVPDI 413

Human   896 ---SPFVRSGTIVRSQTFSPGARSQYVCRLYRSDSDSSTLPRKSPFVRNTLERRTLRYKQSCRSS 957
               :||.|..    :...:.||..|.                         |||           
  Fly   414 AITNPFTRRA----AGNMAGGAGWQQ-------------------------ERR----------- 438

Human   958 LAELMARTSLDLELDLQASRTRQRQLNEELCALRELRQRLEDAQLRGQ 1005
                  |..:.|.:.....|.:|:|.|.   .|.::..|.::.|.|||
  Fly   439 ------RQQMQLHIQQHQQRQQQQQQNR---ILLDVDHRQQEPQHRGQ 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WWC3NP_056506.2 THOC7 <4..119 CDD:283305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..384
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..488
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..544
C2_Kibra 602..725 CDD:176062 25/127 (20%)
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999 22/140 (16%)
WW 248..277 CDD:278809 5/29 (17%)
WW 531..560 CDD:278809
WW 581..613 CDD:197736
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.