DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WWC3 and CG3356

DIOPT Version :9

Sequence 1:NP_056506.2 Gene:WWC3 / 55841 HGNCID:29237 Length:1092 Species:Homo sapiens
Sequence 2:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster


Alignment Length:479 Identity:108/479 - (22%)
Similarity:157/479 - (32%) Gaps:155/479 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    87 HQIKAEIASRRDRLSRLKRELTQMKQELQYKEKGVETLQEIDRKMSSTHTSYKLDEAQAIMSELR 151
            |....:...|:..|.|.||      .||:.||.|...||...|  |..|...:            
  Fly    21 HTCDRDTVIRKAALERQKR------NELRQKENGAVVLQSYAR--SFIHRQRR------------ 65

Human   152 TIKKAICTGEKERRDLMHSLAKLTDSFKNSCSVTDSLVDFPHHVGVPGDAGVPQQFCDAGSQTDI 216
              |:|    |:|..|:..                     ..|..|:..|                
  Fly    66 --KRA----EREVFDIYL---------------------MGHKDGIVED---------------- 87

Human   217 IGEFVFDDKTRLVDRVRLNWQYEEAR--KRVANIQQQL----ARLDNESWPSTAEADRDRLQLIK 275
                  :..|.|:.|:...:...||:  :|:..:.||:    |||...|.|.:...    |:|.|
  Fly    88 ------ESLTFLLRRLNFFYSIREAKDSERLIEVCQQILRQPARLLQHSSPDSLWL----LRLCK 142

Human   276 EKEALLQELQLIIAQRRSAGDVARLEEERERLEEELRRARATSAQGATERILLQ--EKRNCLLMQ 338
            ..:..|  |||.::....|..:        |:.|......:.......|.:|.|  |:....|:.
  Fly   143 LLDTCL--LQLSLSHTAQAIPL--------RMLETFTTVSSVQQYMKDEAVLFQYMERVFGFLIA 197

Human   339 LEEATRLTSYLQSQLKSLCASTLTVSSGSSRGSLASSRGSL-----ASSRGSLSSVS------FT 392
            .....||...|..:...|...||...|..:...|......|     ||:.|.:||:|      ||
  Fly   198 RNYFVRLRRLLDDKCPPLDGETLHAPSPLAEALLQLLLRPLEVAKRASAGGQMSSMSMAVCRNFT 262

Human   393 -DIYGLPQYEKPDAEGSQLLRFDLIPFDSLGRDAPF------------SEPPGPSGFHKQRRS-- 442
             ||...|..:.        ||:.::|..:|..|.||            |..|..|.....|||  
  Fly   263 RDILATPHTDP--------LRYFVLPCFALNVDFPFDLLMRSLYDALESAGPAESDSTSSRRSFL 319

Human   443 ---LDTPQS---LASLSSRSSLSSLSPPSSPLDTPFLPASRDSPL--------AQLADSCEGPGL 493
               ::|...   :.|:.|...|:||    ..||...|.....|||        |::.     |.:
  Fly   320 FYGVETGHKTTRMDSIFSSFLLNSL----MVLDRRQLATLHQSPLLVIYVRLIAEMM-----PNI 375

Human   494 GALDR--LRAHASAM-----GDED 510
            ..|.:  ||.||:|.     ||:|
  Fly   376 LQLPKSTLRGHANAPHRHRDGDDD 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WWC3NP_056506.2 THOC7 <4..119 CDD:283305 9/31 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..384 5/25 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..488 22/93 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..544 1/1 (100%)
C2_Kibra 602..725 CDD:176062
CG3356NP_611896.1 HECTc 766..1120 CDD:238033
HECTc 788..1119 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.