DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WWC3 and pub3

DIOPT Version :9

Sequence 1:NP_056506.2 Gene:WWC3 / 55841 HGNCID:29237 Length:1092 Species:Homo sapiens
Sequence 2:NP_595793.1 Gene:pub3 / 2539956 PomBaseID:SPBC16E9.11c Length:786 Species:Schizosaccharomyces pombe


Alignment Length:423 Identity:85/423 - (20%)
Similarity:147/423 - (34%) Gaps:133/423 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   307 LEEELRRAR--ATSAQGATERILLQEKRNCLLMQLE-EATRLTSYLQSQLKSLC--ASTLTVSSG 366
            :|:..:|.|  ..:|.|.::|.|.::.....::.:: |.|..|..::..:....  ...:||...
pombe     1 MEQGAKRVRFYIVAADGLSKRDLFRQPDPFAILTVDGEQTHTTKVIKKSVNPYWNEGFEVTVKPS 65

Human   367 S---------------SRG--SLASSR----GSLASSR-----GSLSSVSFTDIYGLPQYEKPDA 405
            |               .:|  .|.|.|    ||..|:|     ..|...|.|::..|        
pombe    66 SVISIRLFDQKKFKKKDQGFLGLVSFRMREVGSFRSNREVSLTRPLKKSSTTNLSVL-------- 122

Human   406 EGSQLLRFDLIPFDSLGRDAPFSEPPGPSGFHKQ---RRSLDTPQSLASLSSRSSLSSLSPPSSP 467
             |:.:|:.           || |:...|:|.|..   .|:..||.:..:.::|::    ..|::.
pombe   123 -GNLVLKV-----------AP-SKIRAPAGNHSSTTANRTTSTPTTTTARTTRTT----PRPTAT 170

Human   468 LDTPFLPASRDSPLAQLADSCEGPGLGA-----------LDRLRAHASAMGDEDLPGMAALQPHG 521
            .:|.....|..:.....|.:..|.|.||           .:|...:.||:.:.:...|::.    
pombe   171 TNTSNQSTSNSTRNGTSAATSNGTGTGAGTGASHRSSPVTNRQTNNTSALSNSNAHIMSSF---- 231

Human   522 VPGDGEGPHERGPP--------------------------PASA--PVGGTVTLREDSAKRLERR 558
                 |..:.|.||                          |||:  ||..|    ...::||..:
pombe   232 -----EDQYGRLPPGWERRADSLGRTYYVDHNTRTTTWTRPASSTNPVHNT----SSDSQRLNHQ 287

Human   559 ARRISACLSDYSLASDSGVFEPL--TKRNEDAEEPAYGD----TASNGDPQIHVGLLRDSGSECL 617
            .|.:....:...:.||||...|.  ..|..|...|.:.|    |.:..||:  ..|:|.:|....
pombe   288 NRHLPDDSNPSLMQSDSGNDLPFGWEMRYTDTGRPYFVDHNTRTTTWVDPR--NPLVRPNGGSST 350

Human   618 LVHVLQLKNPAGLAVKEDCKVHIRVYLPPLDSG 650
            :..::|   |..|:           :|.||.||
pombe   351 VGSLMQ---PQSLS-----------HLGPLPSG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WWC3NP_056506.2 THOC7 <4..119 CDD:283305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..384 10/46 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..488 14/68 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..544 10/61 (16%)
C2_Kibra 602..725 CDD:176062 12/49 (24%)
pub3NP_595793.1 HUL4 4..786 CDD:227354 84/420 (20%)
C2_Smurf-like 7..130 CDD:176028 26/142 (18%)
WW 238..267 CDD:278809 2/28 (7%)
WW 308..337 CDD:278809 6/28 (21%)
WW 365..397 CDD:197736 4/5 (80%)
HECTc 434..784 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.