DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sdk1a and DIP-epsilon

DIOPT Version :9

Sequence 1:XP_009297968.1 Gene:sdk1a / 558391 ZFINID:ZDB-GENE-081104-374 Length:2245 Species:Danio rerio
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:404 Identity:84/404 - (20%)
Similarity:160/404 - (39%) Gaps:74/404 - (18%)


- Green bases have known domain annotations that are detailed below.


Zfish   412 ITEAPYFTAEPRRKMMGEVEKSVDIQCQARGVPMPKLEW--YKDAVPLSKLN-----NPRYKII- 468
            |:|.|.|| :....:.....::|.:.|..:.:...|:.|  ::.:..|:..|     |||..:. 
  Fly    48 ISEDPEFT-DVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTH 111

Zfish   469 ------SSMGLQVRKLQPSDAGIFQCFARNSAGEAQVHTYLDVTSMAP-----AFTAPPLDITVT 522
                  .:..|.:..:|..|.|.:.|.......:.|   |..|..:.|     |.|:.  ||.|.
  Fly   112 DKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQ---YGFVKVVVPPNIDDALTSS--DIIVR 171

Zfish   523 DGAVAAFTCRVSGAPKPAIVWRRD--TQILASGSVQIPRFTLLESGGLQIQPVVLQDTGNYTCYA 585
            :|......|:..|:|:|.|.|:||  .:|:.:.::::..   ||:..|:::.:.....|.|.|.|
  Fly   172 EGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHD---LETDSLELERISRLHMGAYLCIA 233

Zfish   586 AN-------SEGAINASASLTVWSRTSISSPPTDRRVIKGTTAILECGATHDPRVGVRYVWKKDE 643
            :|       ....::...|..||....:...|.      |....|||....:| ..:.|..::::
  Fly   234 SNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPI------GFNITLECFIEANP-TSLNYWTREND 291

Zfish   644 ELVSHSRGGRISLQEG--------SLHISQTWSGDIGNYTCDVISEAGNESKEARLEVIELPHS- 699
            ::::.|...:.....|        .|.|:...|.|.|||.|...:..|:.....:|.:...|.: 
  Fly   292 QMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQ 356

Zfish   700 PRNLQASLNANDSRSVDLSWMRPFDG--NSPL------------LHYVVELSENNSPWRVYLSDV 750
            |.....:|....:.:.:::    .||  |:||            .:.|:...:::..:...|:::
  Fly   357 PPPTTTTLRRTTTTAAEIA----LDGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYLSNLNEI 417

Zfish   751 DPSG---TGAMVKG 761
            |.|.   ||:..||
  Fly   418 DKSKQKLTGSSPKG 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sdk1aXP_009297968.1 I-set 125..208 CDD:254352
Ig 125..204 CDD:299845
IG_like 222..302 CDD:214653
Ig 236..287 CDD:299845
Ig_3 322..394 CDD:290638
I-set 323..412 CDD:254352 84/404 (21%)
I-set 416..505 CDD:254352 19/102 (19%)
Ig 436..500 CDD:299845 14/77 (18%)
I-set 510..600 CDD:254352 25/103 (24%)
Ig 527..600 CDD:299845 18/81 (22%)
I-set 605..693 CDD:254352 19/95 (20%)
Ig 610..693 CDD:299845 19/90 (21%)
FN3 697..788 CDD:238020 16/83 (19%)
fn3 800..886 CDD:278470
FN3 901..997 CDD:238020
FN3 1002..1090 CDD:238020
FN3 1100..1196 CDD:238020
FN3 1206..1301 CDD:238020
FN3 1308..1397 CDD:238020
FN3 1408..1501 CDD:238020
FN3 1507..1602 CDD:238020
FN3 1616..1722 CDD:238020
FN3 1732..1825 CDD:238020
FN3 1830..1919 CDD:238020
FN3 1931..2021 CDD:238020
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 17/98 (17%)
Ig 69..139 CDD:143165 14/69 (20%)
IG_like 165..249 CDD:214653 21/88 (24%)
IGc2 172..237 CDD:197706 18/67 (27%)
IG_like 267..348 CDD:214653 17/81 (21%)
Ig 270..339 CDD:299845 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.