DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRKCH and Pkcdelta

DIOPT Version :9

Sequence 1:NP_006246.2 Gene:PRKCH / 5583 HGNCID:9403 Length:683 Species:Homo sapiens
Sequence 2:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster


Alignment Length:417 Identity:199/417 - (47%)
Similarity:262/417 - (62%) Gaps:37/417 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   296 GVNAVELAKTLAGMGLQPG-NISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRL--------- 350
            |.||..|:...||.|...| :.|.:..::..||.   ..:|..|| |...:|..::         
  Fly  1481 GSNAGTLSVPSAGSGSGGGASTSSSPSIIRMSTC---SNDSGFEG-GTAPSSPKKMLETSYTYSQ 1541

Human   351 --------------------GIDNFEFIRVLGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDD 395
                                .:|:|.|:.||||||||||:||.:::|...||:|.|||||:|:||
  Fly  1542 FQKSGRFTAPATVIPRFKNYSVDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDD 1606

Human   396 DVECTMTEKRILSLARNHPFLTQLFCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYA 460
            ||:.|:.|:::|:|...||:|..|||.|||...||||||::||||||||||:|.||.|.|||||.
  Fly  1607 DVDSTLIERKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYG 1671

Human   461 AEIISALMFLHDKGIIYRDLKLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEI 525
            |||||.|.|||.||||||||||||||||:|||.::|||||||..|....|..:|||||||:||||
  Fly  1672 AEIISGLKFLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEI 1736

Human   526 LQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMT 590
            ::...|...||||:.||||||||.|.:||...:||:||.:|.|:...:|.::..:||||||..:.
  Fly  1737 IKGEKYNQNVDWWSFGVLLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLE 1801

Human   591 KNPTMRLGS-LTQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPV 654
            |:.|.|:|| .:..|:  |..|.||:.|||..|..|||||||:|::|...|...||..|.:|...
  Fly  1802 KDYTKRIGSQYSPAGD--IADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVR 1864

Human   655 LTPIDEGHLPMINQDEFRNFSYVSPEL 681
            |||||:..|..::|.:|..|:|.:|.:
  Fly  1865 LTPIDKEILASMDQKQFHGFTYTNPHI 1891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRKCHNP_006246.2 C2_PKC_epsilon 8..140 CDD:175981
C1_1 172..225 CDD:278556
C1_1 246..298 CDD:278556 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..342 5/21 (24%)
S_TKc 355..614 CDD:214567 151/259 (58%)
STKc_nPKC_eta 359..681 CDD:270742 180/322 (56%)
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 151/259 (58%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 179/320 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D222529at2759
OrthoFinder 1 1.000 - - FOG0000117
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R891
SonicParanoid 1 1.000 - - X125
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.