powered by:
Protein Alignment si:ch211-282j17.8 and lectin-22C
DIOPT Version :9
Sequence 1: | XP_021333331.1 |
Gene: | si:ch211-282j17.8 / 557707 |
ZFINID: | ZDB-GENE-041210-290 |
Length: | 310 |
Species: | Danio rerio |
Sequence 2: | NP_001137766.1 |
Gene: | lectin-22C / 7354375 |
FlyBaseID: | FBgn0259230 |
Length: | 263 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 19/65 - (29%) |
Similarity: | 28/65 - (43%) |
Gaps: | 4/65 - (6%) |
- Green bases have known domain annotations that are detailed below.
Zfish 16 DQYVWIGLQKMRVYNWHWS--SGDPLLFLNWMSGQPPSSN--ECTVMINGQWIIEACSNTRVFIC 76
|.:.|:|:..:.......| :|....||.|.||:|...: .|..:.||:.....|..|..|||
Fly 190 DTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMYDYPCHYTFRFIC 254
Zfish 77 76
Fly 255 254
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X29 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.