DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btbd9 and rdx

DIOPT Version :9

Sequence 1:NP_001002198.1 Gene:btbd9 / 557659 ZFINID:ZDB-GENE-040704-39 Length:602 Species:Danio rerio
Sequence 2:NP_650326.3 Gene:rdx / 41704 FlyBaseID:FBgn0264493 Length:829 Species:Drosophila melanogaster


Alignment Length:187 Identity:56/187 - (29%)
Similarity:89/187 - (47%) Gaps:18/187 - (9%)


- Green bases have known domain annotations that are detailed below.


Zfish    22 LSEQLGALVPGEEYSDVTFVVEEKRFPAHRVILAARCQYFRALLYGGLRESRAQAEVRLEETRAE 86
            |||.||.|...|::||||..|..:.|.||:.|||||...|.|:....: |.|....|.:.:...|
  Fly   641 LSEDLGNLFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEM-EERKLNRVAITDVDHE 704

Zfish    87 AFSMLLRYLYTGRATLSEAREETLLDFLGLAHRYGLQPLEVSICEFLRTLLSTRNVCLVFDVASL 151
            ....:||::|||:|...|...:   |.|..|.:|.|:.|:|...|.|...||.........:|.|
  Fly   705 VLKEMLRFIYTGKAPNLEKMAD---DLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADL 766

Zfish   152 YCLNGLAEACMAYMDRNAVEVLKSDGF--LTLSKSALLTVVRRDSFASSEREIFQAL 206
            :..:.|....:.:::.:|.:|:::.|:  :..:.|.|:.            |.|:||
  Fly   767 HSADQLKAQTIDFINTHATDVMETSGWQNMITTHSHLIA------------EAFRAL 811

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btbd9NP_001002198.1 BTB 33..133 CDD:279045 35/99 (35%)
BTB 37..137 CDD:197585 34/99 (34%)
BACK_BTBD9_like 137..195 CDD:269811 10/59 (17%)
F5_F8_type_C <324..406 CDD:279139
rdxNP_650326.3 MATH_SPOP 483..621 CDD:239743
BTB 645..749 CDD:279045 38/107 (36%)
BTB 656..752 CDD:197585 34/99 (34%)
SPOP_C 752..814 CDD:269807 14/72 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.