powered by:
Protein Alignment zgc:175214 and Y73C8C.8
DIOPT Version :9
Sequence 1: | NP_001108199.1 |
Gene: | zgc:175214 / 557610 |
ZFINID: | ZDB-GENE-080303-32 |
Length: | 155 |
Species: | Danio rerio |
Sequence 2: | NP_503853.2 |
Gene: | Y73C8C.8 / 178753 |
WormBaseID: | WBGene00022265 |
Length: | 851 |
Species: | Caenorhabditis elegans |
Alignment Length: | 56 |
Identity: | 18/56 - (32%) |
Similarity: | 27/56 - (48%) |
Gaps: | 1/56 - (1%) |
- Green bases have known domain annotations that are detailed below.
Zfish 81 KKLSLLGQPCAVCLEEFKTRDELGVCP-CSHTFHKKCLLKWLEIRSVCPMCNKPIM 135
|...|..:.|.||||:.....|...|. |...:|..|..||.:::.:||.||..::
Worm 787 KSDDLEDKECLVCLEDMMEEHETLKCSNCKRQYHTGCAQKWFKVKRICPTCNSGLL 842
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C161002132 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.