DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zgc:175214 and plr-1

DIOPT Version :9

Sequence 1:NP_001108199.1 Gene:zgc:175214 / 557610 ZFINID:ZDB-GENE-080303-32 Length:155 Species:Danio rerio
Sequence 2:NP_499473.2 Gene:plr-1 / 176575 WormBaseID:WBGene00023404 Length:487 Species:Caenorhabditis elegans


Alignment Length:102 Identity:33/102 - (32%)
Similarity:45/102 - (44%) Gaps:11/102 - (10%)


- Green bases have known domain annotations that are detailed below.


Zfish    59 RLKQQGTREQYSYNEVVLKGAGKKLSL-------LGQPCAVCLEEFKTRDELGVCPCSHTFHKKC 116
            ||||.  |...|.:...|...|...|:       ..:.|.:||||::...||.|..|.|.||.||
 Worm   281 RLKQH--RSSSSRHSSYLAVFGSLTSVAQSSSHSAQERCVICLEEYEEGTELRVLFCGHEFHPKC 343

Zfish   117 LLKWLEIRSVCPMCNKPIMRLQNP--DAPRGAEGLQD 151
            :..||..:..||:|...::....|  |:|....|..|
 Worm   344 VDPWLLSKRRCPLCQFDVVYKHYPKVDSPEKLSGRSD 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zgc:175214NP_001108199.1 zf-RING_2 90..130 CDD:290367 18/39 (46%)
plr-1NP_499473.2 zf-rbx1 305..358 CDD:289448 18/52 (35%)
zf-RING_2 317..357 CDD:290367 18/39 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.