DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRKAR1B and for

DIOPT Version :10

Sequence 1:NP_002726.1 Gene:PRKAR1B / 5575 HGNCID:9390 Length:381 Species:Homo sapiens
Sequence 2:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster


Alignment Length:165 Identity:34/165 - (20%)
Similarity:57/165 - (34%) Gaps:51/165 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   167 WRRNHNHIWQVLM--YARRVFYKIDTTSP-LNPEA--AVLYE-KDIQLFKSKVVDSVKVCTARL- 224
            |.|..|...::::  ..||:|..:..|:. |:|.|  .||.| ..:...:.|.|:...|...:. 
  Fly    34 WLRFQNLTNEMIVTKNGRRMFPVVKVTATGLDPTAMYTVLLEFSQVDSHRWKYVNGEWVAGGKAE 98

Human   225 ---------------FDQPKIEDPYAISFS--------------------PWNPSVHDEAREKML 254
                           |.|..:::|  |||:                    .:.|.||       |
  Fly    99 APPPNPVYVHPESPNFGQHWMKEP--ISFAKVKLTNKTNGNGQIMLNSLHKYEPRVH-------L 154

Human   255 TQKKPDEQHNKSVHVAGLSWVKPGSVQPFSKEEKT 289
            .|...|.:..::||.......:..:|..:..||.|
  Fly   155 VQVVSDARDQRNVHTYPFPETQFIAVTAYQNEEVT 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRKAR1BNP_002726.1 Dimerization and phosphorylation 2..136
DD_RIbeta_PKA 11..64 CDD:438523
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..98
Pseudophosphorylation motif 96..100
CAP_ED 137..246 CDD:237999 23/120 (19%)
CAP_ED 255..370 CDD:237999 8/35 (23%)
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
CAP_ED 520..629 CDD:237999
CAP_ED 638..754 CDD:237999
STKc_cGK 783..1043 CDD:270724
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.