DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igsf9a and DIP-epsilon

DIOPT Version :9

Sequence 1:XP_005155702.1 Gene:igsf9a / 557459 ZFINID:ZDB-GENE-060503-288 Length:1619 Species:Danio rerio
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:463 Identity:102/463 - (22%)
Similarity:172/463 - (37%) Gaps:121/463 - (26%)


- Green bases have known domain annotations that are detailed below.


Zfish    27 EHVRAKKDSSAVLPCSLPAPQKDSSASQYVIEWVRQGFDTPIFMQLGVH-----PRV---HPDYD 83
            |::......:..|.||:      .:...|.:.|:.  |:....:.:..|     ||:   |..:|
  Fly    59 ENITVPAGRNVKLACSV------KNLGSYKVAWMH--FEQSAILTVHNHVITRNPRISVTHDKHD 115

Zfish    84 GRVSLFGGTSLQMSGLQLEDEGWYECRILPLDQTTEEAGSSGSWTRLSVTAPPVLTET-SPPEVE 147
            ...:.|    |.::.:|.||.|.|.|:|..:...|:       :..:.|..||.:.:. :..::.
  Fly   116 KHRTWF----LHINNVQEEDRGRYMCQINTVTAKTQ-------YGFVKVVVPPNIDDALTSSDII 169

Zfish   148 VFVGRSLTLKCAAQGNPRPTITWSKDGAPIKPQHKVKMVNGSVSFH----------AVSREAAGQ 202
            |..|.::||:|.|:|:|.|||.|.:|..     :|: ::|.::..|          .:||...|.
  Fly   170 VREGDNVTLRCKAKGSPEPTIKWKRDDG-----NKI-VINKTLEVHDLETDSLELERISRLHMGA 228

Zfish   203 YQCYTSNS-EGNATHVTRLKIIGPPVIIIPPSDTVLNMSQDAKLKCQAEADPPNMTYVWQRQGVD 266
            |.|..||. ..:.:...::.:...|::.||.....:.:..:..|:|..||:|.::.| |.|:. |
  Fly   229 YLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNY-WTREN-D 291

Zfish   267 IYHIDSLKSRIKVI-------VDGTLLISRLAPEDSGNYTCMPTNGLPVSPSASAVLTVQHPAQV 324
            ....:|.|.:.:.|       ....|.|:.:...|.|||.|:..|                    
  Fly   292 QMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKN-------------------- 336

Zfish   325 IQMPKLTFLPTG-MRGAI----VCPVRAEPPLSHIDWIKDGKPLDLGMYPGWTLASDGSIVIATV 384
                     |.| |.|.|    ..|...:||                  |..|.....:...|.:
  Fly   337 ---------PRGDMDGNIKLYMSSPPTTQPP------------------PTTTTLRRTTTTAAEI 374

Zfish   385 NDDAAGVYICTPY--NSFGTTGQSEPTTVILQDPPSFK-VSPRNEYRQDVGTMLVIPCQMVGNPA 446
            ..|.   ||.||.  |..|..|:....:||.....|.| :|..||..:..        |.:...:
  Fly   375 ALDG---YINTPLNGNGIGIVGEGPTNSVIASGKSSIKYLSNLNEIDKSK--------QKLTGSS 428

Zfish   447 PK-VNWRK 453
            || .:|.|
  Fly   429 PKGFDWSK 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
igsf9aXP_005155702.1 IG_like 27..110 CDD:214653 19/90 (21%)
Ig 35..111 CDD:299845 19/83 (23%)
I-set 140..221 CDD:254352 23/92 (25%)
IGc2 151..212 CDD:197706 22/71 (31%)
Ig 233..318 CDD:299845 20/91 (22%)
I-set 233..318 CDD:254352 20/91 (22%)
Ig <349..402 CDD:299845 11/54 (20%)
IG_like 423..502 CDD:214653 7/32 (22%)
Ig 435..498 CDD:143165 5/20 (25%)
FN3 507..602 CDD:238020
fn3 614..696 CDD:278470
PHA02666 1105..>1312 CDD:222914
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 23/114 (20%)
Ig 69..139 CDD:143165 19/81 (23%)
IG_like 165..249 CDD:214653 23/89 (26%)
IGc2 172..237 CDD:197706 22/70 (31%)
IG_like 267..348 CDD:214653 25/111 (23%)
Ig 270..339 CDD:299845 21/99 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.