DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment igsf9a and dpr3

DIOPT Version :9

Sequence 1:XP_005155702.1 Gene:igsf9a / 557459 ZFINID:ZDB-GENE-060503-288 Length:1619 Species:Danio rerio
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:392 Identity:85/392 - (21%)
Similarity:129/392 - (32%) Gaps:153/392 - (39%)


- Green bases have known domain annotations that are detailed below.


Zfish    18 LFNDTSAAEEHVRAKKDSSAVLPCSLPAPQKDSSASQYVIEWVRQGFDTPIF------------- 69
            ||..|.|..|...|..:.|           :|:..||          ..|||             
  Fly   208 LFAQTDAKRERSGAADEES-----------QDADTSQ----------SLPIFDFGMPRNITGRTG 251

Zfish    70 -MQLGVHPRVHPDYDGRVS---------LFGGTSLQMSGLQLE--------------------DE 104
             .:..:..||...:|..||         |..||:...|..:.:                    |.
  Fly   252 HTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDS 316

Zfish   105 GWYECRILPLDQTTEEAGSSGSWTRLSVTAPPVLTETS-PPEVEVFVGRSLTLKCAAQGNPRPTI 168
            |.|||::     .||...|......:...:|......| ||::....|.::.|.|..|   :|::
  Fly   317 GIYECQV-----NTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILNCLVQ---QPSV 373

Zfish   169 TWSKDGAPI---KPQHKVKMVNGSVSFHAVSREAAGQYQCYTSNSEGNATHVTRLKIIGPPVIII 230
               ||..||   :.:|.:      ..|.|..    ||.:.    ..|...|        |..|  
  Fly   374 ---KDIGPIYWYRGEHMI------TPFDADD----GQPEI----PAGRGEH--------PQGI-- 411

Zfish   231 PPSDTVLN--MSQ-DAKLKCQAEADPPNMTYVWQRQGVDIYHIDSLKSRIKVIVDGTLLISRLAP 292
             |.||..|  ||: |.:::...            |..::....|:||||::        ||....
  Fly   412 -PEDTSPNDIMSEVDLQMEFAT------------RIAMESQLGDTLKSRLR--------ISNAQT 455

Zfish   293 EDSGNYTCMPTNGLPVSPSASAVLTV---QHPA-------------------QVIQMPKLTFLPT 335
            .|:|||||.||    .:.|||.::.|   ::||                   .::.:|:|..|..
  Fly   456 TDTGNYTCQPT----TASSASVLVHVINDENPAAMQKSGACPCALGPLQLLLHLLLLPELLLLRA 516

Zfish   336 GM 337
            |:
  Fly   517 GL 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
igsf9aXP_005155702.1 IG_like 27..110 CDD:214653 22/125 (18%)
Ig 35..111 CDD:299845 21/118 (18%)
I-set 140..221 CDD:254352 19/84 (23%)
IGc2 151..212 CDD:197706 14/63 (22%)
Ig 233..318 CDD:299845 25/87 (29%)
I-set 233..318 CDD:254352 25/87 (29%)
Ig <349..402 CDD:299845
IG_like 423..502 CDD:214653
Ig 435..498 CDD:143165
FN3 507..602 CDD:238020
fn3 614..696 CDD:278470
PHA02666 1105..>1312 CDD:222914
dpr3NP_001014459.2 Ig 243..330 CDD:299845 16/91 (18%)
IG_like 243..329 CDD:214653 16/90 (18%)
Ig 350..464 CDD:299845 40/164 (24%)
IG_like <441..477 CDD:214653 18/47 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.