DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RADIL and MYO4

DIOPT Version :9

Sequence 1:NP_060529.4 Gene:RADIL / 55698 HGNCID:22226 Length:1075 Species:Homo sapiens
Sequence 2:NP_009373.1 Gene:MYO4 / 851204 SGDID:S000000027 Length:1471 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:62/308 - (20%)
Similarity:122/308 - (39%) Gaps:61/308 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   507 LFWMSNSIELLYFIQQKCPLYMQSMEEQLDITGSKESLFSCTLTASE-EAMAVLEEVVLYAFQQC 570
            :||:||...|..|...:..||..:..::      |:.|....|...| |.:.|.:::......:.
Yeast  1187 IFWLSNLSRLPAFAANQKTLYEANGGDE------KDKLTLIYLNDLENETLKVFDKIYSTWLVKF 1245

Human   571 VYYVSKSLYICLPALLECPPFQTERRESWSSAPELPEELRRVVSVYQAALDLLRQLQVHPEVASQ 635
            :.:.|..:.| ...:|....|:....|.::.......|...|:..:| .:|     .:|.::.:.
Yeast  1246 MKHASAHIEI-FDMVLNEKLFKNSGDEKFAKLFTFLNEFDAVLCKFQ-VVD-----SMHTKIFND 1303

Human   636 MLAYLFFFSGTLLLNQLLDRGPSLSCFHWPRGVQACARLQQLLEWMRSAGFGAAGEHFFQKL-SC 699
            .|.||    ..:|.|.|:.:.|:|   :|..|.:....:::|:.|            |..:: ..
Yeast  1304 TLKYL----NVMLFNDLITKCPAL---NWKYGYEVDRNIERLVSW------------FEPRIEDV 1349

Human   700 TLNLLATPRA-QLIQMSWTAL---RAAFP---ALSPAQLHRLLTHYQLASAMGPMSTWEPGAQDS 757
            ..||:...:| :::|:..:.|   :..|.   ||:|||:..:|..|:      |.:..|.|..: 
Yeast  1350 RPNLIQIIQAVKILQLKISNLNEFKLLFDFWYALNPAQIQAILLKYK------PANKGEAGVPN- 1407

Human   758 PEAFRSEDVLESYEN---PPPIVLPSDGFQVDLEANCLDDSIYQHLLY 802
                   ::|....|   ...:.||.   ::::..:...||...||.|
Yeast  1408 -------EILNYLANVIKRENLSLPG---KMEIMLSAQFDSAKNHLRY 1445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RADILNP_060529.4 RA 61..164 CDD:279168
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..237
FHA 273..343 CDD:278899
Myo5p-like_CBD_Rasip1 414..779 CDD:271256 55/283 (19%)
DUF4764 <809..935 CDD:292583
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 872..967
PDZ_signaling 974..1058 CDD:238492
MYO4NP_009373.1 COG5022 2..1471 CDD:227355 62/308 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.