DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YEATS2 and gfl-1

DIOPT Version :10

Sequence 1:NP_001338299.1 Gene:YEATS2 / 55689 HGNCID:25489 Length:1423 Species:Homo sapiens
Sequence 2:NP_502172.1 Gene:gfl-1 / 187434 WormBaseID:WBGene00001585 Length:211 Species:Caenorhabditis elegans


Alignment Length:115 Identity:38/115 - (33%)
Similarity:65/115 - (56%) Gaps:6/115 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   196 DLTDETSRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHP 260
            ::.:...:..:.|.||.||.:  .|...:.::||.||:|.|:::....|.. ..:::||.|.||.
 Worm     3 EIVERMKKKNIVKPIVYGNTA--TPFGYKRDSDQHTHQWTVFLKPYLIEDP-TKWIRKVQFKLHE 64

Human   261 SYK-PNDLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKRIDIIHNLKL 309
            ||. |..:||  :||:.:|..|||||.::::::|.|...|.|...|.|:|
 Worm    65 SYAVPYRVVE--KPPYEVTETGWGEFEIQIRIYFVDPNEKPITAFHYLRL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YEATS2NP_001338299.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..198 0/1 (0%)
YEATS_YEATS2_like 208..331 CDD:341126 38/103 (37%)
Histone H3K27cr binding. /evidence=ECO:0000269|PubMed:27103431, ECO:0007744|PDB:5IQL 259..261 1/1 (100%)
Histone H3K27cr binding. /evidence=ECO:0000269|PubMed:27103431, ECO:0007744|PDB:5IQL 282..284 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 466..487
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 514..541
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 795..843
DUF5585 <869..>1119 CDD:465521
gfl-1NP_502172.1 YEATS_GAS41_like 11..147 CDD:341128 38/107 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.