DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRKACG and for

DIOPT Version :9

Sequence 1:NP_002723.2 Gene:PRKACG / 5568 HGNCID:9382 Length:351 Species:Homo sapiens
Sequence 2:NP_477487.1 Gene:for / 44817 FlyBaseID:FBgn0000721 Length:1088 Species:Drosophila melanogaster


Alignment Length:290 Identity:121/290 - (41%)
Similarity:192/290 - (66%) Gaps:5/290 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    47 LRTLGMGSFGRVMLVR-HQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFS 110
            :.|||:|.||||.||: :.::...:|:|.:.|.::|:.:|.:||::||.|:...:..|:|||..:
  Fly   780 IATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKT 844

Human   111 FKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLI 175
            |||..|||::||...|||:::.|:..|.|.:....||.|.||.|..||||.::|:|||||||||:
  Fly   845 FKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLL 909

Human   176 DQQGYLQVTDFGFAKRVK-GR-TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPP 238
            :::||:::.||||||::: || |||.||||||:|||:||::|::.:.|:|:||||::|:..|.||
  Fly   910 NERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPP 974

Human   239 FYADQPIQIYEKIVSG--RVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATT 301
            |....|::.|..|:.|  .:.||..::.:..:|::.|.:.:..:|.|..|.|:.:|:.||||...
  Fly   975 FTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGF 1039

Human   302 SWIAIYEKKVEAPFIPKYTGPGDASNFDDY 331
            .|..:....:|.|..|......|.:|||||
  Fly  1040 YWWGLQNCTLEPPIKPAVKSVVDTTNFDDY 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRKACGNP_002723.2 PTZ00426 36..351 CDD:173616 121/290 (42%)
STKc_PKA 42..331 CDD:271111 119/288 (41%)
forNP_477487.1 DD_cGKI-alpha 385..432 CDD:213374
Crp 518..>627 CDD:223736
CAP_ED 520..629 CDD:237999
Crp 632..>753 CDD:223736
CAP_ED 638..754 CDD:237999
S_TKc 778..1036 CDD:214567 109/255 (43%)
STKc_cGK 783..1043 CDD:270724 111/259 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0616
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.