DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRKACG and CG4839

DIOPT Version :9

Sequence 1:NP_002723.2 Gene:PRKACG / 5568 HGNCID:9382 Length:351 Species:Homo sapiens
Sequence 2:NP_609349.1 Gene:CG4839 / 34348 FlyBaseID:FBgn0032187 Length:1003 Species:Drosophila melanogaster


Alignment Length:306 Identity:124/306 - (40%)
Similarity:187/306 - (61%) Gaps:17/306 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    43 QFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRI-LQAIDFPFLVK 106
            :.:::.|||.|:||||.||.:.:..  .|:||:.|.:|||..|:||:.|||.: ::....||:|:
  Fly   693 ELKKIATLGCGAFGRVDLVAYNQQA--LALKIIKKIEVVKQDQIEHVYNEKNVMIKCRQSPFIVQ 755

Human   107 LQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPE 171
            |..:::::.|:|.:||...||::::.:.:...|.|..|.|.|..||.|..||||...|:||||||
  Fly   756 LYRTYRNDKYVYFLMEACMGGDVWTVMSKRQYFDEKTAKFIAGCVVEAFDYLHSHHFIYRDLKPE 820

Human   172 NLLIDQQGYLQVTDFGFAK--RVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAV 234
            ||::...||.::.||||||  |...:|.|..|||||:||||||.:|:::|||:||||:|:||:.|
  Fly   821 NLMLGTDGYCKLVDFGFAKFVRQNEKTNTFAGTPEYVAPEIILDRGHDRAVDYWALGILVYELLV 885

Human   235 GFPPFYADQPIQIYEKIVSG--RVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKW 297
            |..||.....|:||::|:||  .:..||::....:||:|.|.:....:|.|..|.|:.|||.|.|
  Fly   886 GKTPFRGVNQIKIYQQILSGIDVIHMPSRIPKSAQHLVRHLCKQLPAERLGYQRKGIADIKRHSW 950

Human   298 FATTSWIAIYEKKVEAPFIP--------KYTGPGDASNFDDYEEEE 335
            |.:..|..:..|::.:|...        :|.||....|  |||..|
  Fly   951 FESLDWQRLKLKQLPSPIKRPLKSWTDLQYFGPSGVEN--DYEPPE 994

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRKACGNP_002723.2 PTZ00426 36..351 CDD:173616 124/306 (41%)
STKc_PKA 42..331 CDD:271111 120/300 (40%)
CG4839NP_609349.1 Crp 428..577 CDD:223736
CAP_ED 431..539 CDD:237999
Crp 544..>650 CDD:223736
CAP_ED 550..663 CDD:237999
S_TKc 695..951 CDD:214567 111/257 (43%)
STKc_cGK 700..957 CDD:270724 112/258 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.