DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC30A6 and RpL31

DIOPT Version :10

Sequence 1:NP_001180442.1 Gene:SLC30A6 / 55676 HGNCID:19305 Length:501 Species:Homo sapiens
Sequence 2:NP_610503.1 Gene:RpL31 / 35988 FlyBaseID:FBgn0285949 Length:124 Species:Drosophila melanogaster


Alignment Length:77 Identity:25/77 - (32%)
Similarity:39/77 - (50%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   300 PHVIGQLDKLI-REVSTLDGVLEVR-NEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYT 362
            |..|.::.|.. ||:.|.|..::.| |:|.|:.|..|....:.||:.|..|:.   ....|:|||
  Fly    40 PRAIKEIRKFAEREMGTTDVRIDTRLNKHIWSKGIRSTPFRIRVRLARRRNDD---EDSPNKLYT 101

Human   363 LVSTLTVQIFKD 374
            .|:.:.|..||:
  Fly   102 YVTYVPVSTFKN 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC30A6NP_001180442.1 CzcD 113..371 CDD:440843 23/72 (32%)
RpL31NP_610503.1 Ribosomal_L31e 16..97 CDD:460108 17/59 (29%)

Return to query results.
Submit another query.